KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6510Help
Entry
Bcen2424_6510     CDS       T00415                                 

Definition
(GenBank) Methyltransferase type 12
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 CMAS Methyltransf_11 Methyltransf_12 Methyltransf_31 Methyltransf_PK Methyltransf_3 Methyltransf_9 MTS Methyltransf_2 Methyltransf_20 Methyltransf_4 Methyltransf_18 CheR
Motif
Other DBs
NCBI-ProteinID: ABK13240
Position
3:complement(731719..732681)
Genome map
AA seq 320 aa AA seqDB search
MNQISEQAIAELRAPHLEPALPIRVLHGETVSDYERKVQTTYAGSPDDWRKAIGEYLLFQ
FGVYDDPRSTPPISLDESGIRYFERQLHLAGFDDPVPARVERILDIGCGWGYILKYLAGR
FPGCMRLDGINVSREQLDYCARFHAQHGLAERINLYQCNAQDVDRLPDPATPYDLVIIRG
VISHFPNALYEKAMRALHARVRGGGSVVISDNLYNVDLSEYASDTPDEVDRIACKHRKTP
DYFRQVLIDAGFAIRDMRVLPSNIDVARWLMDAKANIDRHFPHRAPDTLEELRVLAENWS
VALIKNKVSTYSIVAVKPDA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcagcgaacaggcgatcgccgaactgcgcgcgccgcacctggaacccgcc
ctgccgatccgggtgctgcatggcgagacggtgagcgattacgagcggaaagtgcagacg
acctacgccggcagcccggacgactggcgcaaggcgatcggcgagtacctgttgttccag
ttcggtgtgtacgacgatccgcgctccacgccgccgatctcgctcgatgaatcgggcatt
cgctacttcgaacgccagcttcatctcgccggcttcgacgaccccgttcccgcccgggtc
gaacgcattctcgacatcggctgcggctggggctacatcctcaagtatctggccggccgc
ttccccggctgcatgcgcctcgacggtatcaacgtcagtcgcgaacagctcgactactgc
gcccgctttcatgcgcaacacgggctcgcggaacgcatcaacctgtatcagtgcaacgca
caggacgtcgatcgactgcccgatcccgcgacaccatacgatctcgtgatcattcgcggc
gtgatctcgcatttcccgaacgcgctgtacgaaaaggcgatgcgcgcgctgcatgcgcgt
gtacgcggcggcggctcggtggtcatctcggacaatctgtacaacgtcgacctgagcgaa
tacgcgtccgacacgcccgacgaggtcgaccggatcgcatgcaagcaccgcaagacgccc
gattatttcaggcaggtgctgatcgacgccgggttcgcgatccgcgacatgcgcgtgctg
ccgtcgaacatcgacgtcgcgcgctggctgatggatgccaaggccaacatcgaccgccat
tttccgcaccgtgcgccggacacgctggaagaactgcgcgtgctcgccgaaaactggtcc
gtcgcgctgatcaagaacaaggtgtcgacctacagcatcgtcgcggtcaaaccggacgcg
taa

DBGET integrated database retrieval system