KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6515Help
Entry
Bcen2424_6515     CDS       T00415                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_24 HTH_20 HTH_IclR AbiEi_4 GntR HTH_Crp_2 HTH_AsnC-type HTH_11 MarR RRF_GI
Motif
Other DBs
NCBI-ProteinID: ABK13245
Position
3:736364..737266
Genome map
AA seq 300 aa AA seqDB search
MLNRLDILKIFAAAAAAPTFREAAARLGVSPQVVTRAVRELEEMLGETLFHRTTRSIRIT
AFGQSFAREVQGALAVVDGLFGPATGQRDEPVGVVRITAPSGMGRHYVQPILTGLMQRYP
GLVPDLRLSDVPSPVVDEQIDIGVRVGAIGDNRFVARMVGPLPMWVVAAPSLIRRLGEPK
NRKALEAMPVTCLIDRASGRPWPWMFRGEQQFVPSSPAYLTDDTEVEIEAVCAGVGVGQC
SEYLVRPYVRKGRLVRVLPSLEPEPWKLHVYRPRRGPMPRRIRVVYDELVAKLAEATWRE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaccgcctcgacatcctgaagatctttgccgcggccgccgcggcgccgacgttt
cgcgaggcggccgcgcggctcggcgtgtcgccgcaggtcgtcacgcgcgcggtgcgcgaa
ctggaggagatgctcggcgaaacgctgtttcaccggacgacccgcagcatccggatcacc
gcgttcggccagtcgttcgcgcgcgaggtgcagggcgcgctggccgtggtcgacgggctg
ttcgggcccgcgaccggccagcgcgacgagccggtcggcgtcgtccggatcaccgcgccg
tcgggcatggggcggcattacgtgcagccgatcctcaccggcctcatgcagcgatatccg
gggctcgtgcccgatctgcggctgtcggacgtgccgtcgccggtggtcgacgagcagatc
gacatcggcgtgcgtgtcggcgcgatcggcgacaaccgcttcgtcgcgcgcatggtcggg
ccgctgccgatgtgggtggtggccgcgccgtcgctgatccggcggctgggcgagccgaaa
aaccgcaaggcactcgaagcgatgccggtgacgtgcctgatcgatcgtgcaagcgggcgg
ccgtggccgtggatgtttcgcggcgagcagcagttcgtgccgtcgtcgccggcttacctg
acggacgacaccgaggtggagatcgaggccgtgtgcgcgggggtgggagtcggccagtgt
tcggaatatctggtgcggccgtacgtcaggaaggggcgcctcgtgcgggtgttgccgagc
ctcgagcccgagccgtggaagctgcacgtctatcggccgcggcgcgggccgatgccgcgt
cgtatccgggtggtgtacgacgaactggtggcgaagctcgcggaggcgacgtggcgggag
tag

DBGET integrated database retrieval system