KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6516Help
Entry
Bcen2424_6516     CDS       T00415                                 

Definition
(GenBank) helix-turn-helix, Fis-type
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_8 HTH_28 HTH_30 HTH_29 HTH_1 HTH_7 HTH_Tnp_ISL3 HTH_23 HTH_11 HTH_Tnp_1 HTH_22 HTH_20 HOIP-UBA HTH_17
Motif
Other DBs
NCBI-ProteinID: ABK13246
Position
3:complement(737405..738586)
Genome map
AA seq 393 aa AA seqDB search
MERSVNTAPESLSRPVDLDRLRARFAAGEPLPETALPASVARSWLRSRDAGLRPWQTARY
EMQREPAESRADRRLTRCVAQEIEPLWAAFGGSEWTIMCVNPHGTIVHARRSPQCDDALL
TPIVAGRRIVEPNIGTTAPSCVIHDGAETVVAGAQHYLDELSRVFCLAVPLVGFDGEVIG
ALDITGIGRRNIAQLRESFRHASLSAEQRLYAILRDCHLLQVQFDPRWLGTPLAGVIALD
EAGRVRAVSRLARQMLDLAPAGPVAPVDLRQLFPGATPAQQRRLLTPARTPQRIARDDGS
HVWVRTVRAPLDRATRARHADVLEDAADVCNVASAAGPQASLHEQSLDAIRRALDEHDGN
VSAAARQLGISRTTLYAKLRQLDAAGIRHDGPH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagcgtgaacacggcccctgaatccctttcacggccggtcgacctcgaccgg
ctccgcgcccgcttcgccgcgggcgagccgctgccggaaacggcgttgccggccagcgtc
gcgcgttcgtggctgcgttcgcgcgacgccgggctgcggccctggcaaaccgcccgctat
gaaatgcagcgcgaacccgccgaatcgcgcgcggaccggcggctcacccgctgcgtcgcg
caggagatcgagccgctgtgggccgcattcggcggcagcgaatggacgatcatgtgcgtc
aatccgcacggcacgatcgtccatgcgcgccgcagcccgcaatgcgacgacgcgctgctc
acgccgatcgtcgccgggcgccggatcgtcgaaccgaacatcggcacgaccgcgccgagc
tgcgtgattcacgacggcgccgaaaccgtcgtcgcgggcgcgcagcactatctcgacgag
ttgtcgcgagtgttctgtctggccgtgccgctcgtgggtttcgacggcgaagtgatcggc
gcgctcgatatcaccggcatcggccggcgcaatatcgcgcagctgcgcgagtcattccgg
cacgcatcgctgtccgccgaacagcggctctatgcgatattgcgcgactgccatctgctg
caggtgcaattcgatccgcgctggctcggcacgccgctcgccggcgtcatcgcgctcgac
gaagcgggccgcgtgcgcgcggtgagccgcctggcccgccagatgctcgatctcgcgccc
gccgggccggtggcgccggtcgatctccggcaactgtttccgggcgcgacgcccgcgcag
cagcgccggttgctgacaccggcacgtacgccgcagcggatcgcgcgcgacgatggtagc
cacgtatgggtgcgcaccgtgcgtgcgccgctcgatcgcgcgaccagggcgcggcacgcc
gatgtgctcgaagacgctgccgacgtgtgcaacgtcgcgtcggccgccggcccgcaggcg
agcctgcacgaacagtcgctcgacgcgatccgccgcgcgctcgacgagcacgacggcaac
gtgtcggcggccgcgcggcagctcggtatttcacgcacgacgctgtacgcgaaacttcgg
cagctcgatgcggcagggatcaggcacgacgggccgcattga

DBGET integrated database retrieval system