KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6517Help
Entry
Bcen2424_6517     CDS       T00415                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00055  aryl-alcohol dehydrogenase [EC:1.1.1.90]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00350  Tyrosine metabolism
bch00360  Phenylalanine metabolism
bch00622  Xylene degradation
bch00623  Toluene degradation
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
bch01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Bcen2424_6517
   00360 Phenylalanine metabolism
    Bcen2424_6517
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Bcen2424_6517
   00622 Xylene degradation
    Bcen2424_6517
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.90  aryl-alcohol dehydrogenase
     Bcen2424_6517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABK13247
Position
3:complement(738729..739856)
Genome map
AA seq 375 aa AA seqDB search
MYTEHDTRAVTAAVARAAGAPFSIEAARIRAPRGDEVLVRVVATGLCHTDLIVRDQYYPV
PLPAVLGHEGAGVVEAVGPNVKTLAAGDHVVLTYGACGHCTSCVGGHGAYCRQFFALNFG
GADADGQTALRDASGQPLHDHFFAQSSFASYALARENNAIKVPKEAPLELLGPLGCGIQT
GAGAVINSLAVRTGSSFASFGAGAVGMSAVMAARIAGATTIIAVDIVPSRLALALELGAT
HALDSREVDVVDAIREITGGGVDFALESTGLPAVLSQGIDALGSRGTMGVVGAPKLGTRA
EFDVNSLLLGGHTIRGIVEGDSVPQTFIPQLVQLHLQGRFPFDRLVKFYPLDQINQAAED
SSKGITLKPILRLPH
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtacaccgaacacgacacacgcgccgtcaccgcggccgtcgcgcgcgccgccggcgcg
cccttctcgatcgaagcggcccgcatccgcgcgccgcgcggcgacgaagtgctggtgcgc
gtcgtcgcgaccggcttgtgccataccgacctgatcgtgcgcgaccagtactatccggtg
ccacttcccgccgtgctcggtcacgaaggcgccggcgtggtcgaggcggtcggcccgaac
gtgaagacgctcgccgccggcgaccacgtcgtgctgacctacggcgcgtgcggtcactgc
acgtcgtgcgtcggcggtcacggcgcgtattgccggcagtttttcgcgctgaacttcggc
ggcgccgacgcggacgggcagaccgcgcttcgtgacgcatccggccagccgctgcacgat
catttcttcgcgcagtcgtcgttcgcgagctacgcgctcgcccgcgaaaacaacgcgatc
aaggtgccgaaggaagcgccgctcgaactgctcggcccgctcggctgcgggatccagacc
ggtgcgggcgccgtcatcaattcgctcgcggtgcgcaccggcagcagcttcgcgagcttt
ggcgcgggcgcggtcgggatgagcgcggtgatggccgcgcgcatcgccggcgcaacgacg
atcatcgcggtcgacatcgtaccgtcgcggctcgcgctggcgctggaactcggcgcgacg
cacgcgctcgacagccgggaggtcgacgtggtcgacgcgatccgggagatcaccggcggc
ggcgtcgacttcgcgctcgaatcgaccgggctgccggcggtgttgtcgcaagggatcgac
gcgctcggctcgcgcggcacgatgggcgtggtcggcgcgccgaagctcggcaccagggcc
gaattcgacgtgaacagcctgctgctcggcggccacacgatccgcggcatcgtcgaaggc
gacagcgtgccgcagacgttcattccgcaactcgtgcaactgcatctgcaagggcggttt
ccgttcgaccggctggtaaagttctatccgctcgaccagatcaaccaggcggcggaagac
agcagcaaggggatcacgctcaagccgatcctgcgtttgccgcattga

DBGET integrated database retrieval system