KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6522Help
Entry
Bcen2424_6522     CDS       T00415                                 

Definition
(GenBank) hypothetical protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABK13252
Position
3:complement(745471..745713)
Genome map
AA seq 80 aa AA seqDB search
MRFSSVRRGCEVRIEHRHRAMHRGRGQLALAARRQIDDAGFDAISGGGGRGARCVGYSWN
GFIRGGEMARPILLVALFDT
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
gtgcgattttcgtcagtccgtcgcgggtgcgaggtacgcatcgagcatcggcatcgggcc
atgcatcgtggccgcggacaacttgcgctggcggctcgccgacagattgacgacgcaggt
ttcgatgcgatctcgggcggcggaggacgcggagcgcgctgcgtgggctattcatggaac
ggatttatacgcggcggggaaatggcgcgtccaatacttttggtcgcgctttttgatacc
tga

DBGET integrated database retrieval system