KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6523Help
Entry
Bcen2424_6523     CDS       T00415                                 

Definition
(GenBank) catechol 1,2-dioxygenase
  KO
K03381  catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00361  Chlorocyclohexane and chlorobenzene degradation
bch00362  Benzoate degradation
bch00364  Fluorobenzoate degradation
bch00623  Toluene degradation
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
bch01220  Degradation of aromatic compounds
Module
bch_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen2424_6523
   00364 Fluorobenzoate degradation
    Bcen2424_6523
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bcen2424_6523
   00623 Toluene degradation
    Bcen2424_6523
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     Bcen2424_6523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg DUF4198
Motif
Other DBs
NCBI-ProteinID: ABK13253
Position
3:745768..746718
Genome map
AA seq 316 aa AA seqDB search
MSVKVFDTTEVQDLLKAASNAAGNRGNGTNGDARTQQIVLRLLGDLFKAIDDLDITPDEV
WAGVNYLNKLGQDSEAALLAAGLGLEKYLDIRMDAADKAIGLDGGTPRTIEGPLYVAGAP
VRDGVAKIDLDADDGAGPLVIQGTVTGLDGKPIAGAVVECWHANSHGFYSHFDPTGKQSD
FNLRGAVRTGADGKYEFRTLMPVGYGCPPQGATQQLLNRLGRHGNRPAHVHFFVDSPAHR
KLTTQFNIDGDPLIWDDFAYATREELIPPVTEKTGGTALGMKADAYQDIEFNFVLTPRVQ
GRDNQIVERLRASATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaaagttttcgacacgacggaagtgcaggatctgctgaaggccgcatcgaac
gcggccgggaatcgcggaaatggcacgaacggcgacgcacgtacgcagcagatcgtgctg
cgcctgctcggcgacctgttcaaggcgatcgacgatctcgacatcacgcccgacgaagtg
tgggccggcgtgaactacctgaacaaacttggtcaggatagcgaagcggcgctgctcgcg
gccggtctcggtctcgagaaatatctcgacatccggatggacgccgcggacaaggcgatc
ggcctcgacggcggcacgccacgcacgatcgaggggccgctgtacgtggcgggcgccccg
gtgcgcgacggcgtcgcgaagatcgacctcgatgcggacgacggcgcgggcccgctcgtg
atccaaggcacggtcacgggcctggacggcaagccgatcgccggcgcggtggtcgaatgc
tggcatgcgaattcgcacggcttctattcgcatttcgacccgaccggcaagcagagcgac
ttcaatctgcgcggcgcggtgaggaccggcgcggacggcaaatacgaattccgcacgctg
atgccggtcggctacggctgcccgccgcagggcgcgacgcagcaactgctgaatcgcctc
ggccgccacggcaaccgccccgcacacgtgcacttcttcgtcgacagccccgctcaccgc
aagctgacgacgcagttcaacatcgacggagatccgctgatctgggacgacttcgcgtat
gcgacgcgcgaggagctgattccacccgtgaccgaaaagaccggcggcaccgcgctcggc
atgaaggccgacgcgtaccaggacatcgagttcaacttcgtgctgacgccgcgcgtgcag
ggcagggacaaccagatcgtcgaacgcctgcgcgcgtccgccaccgcataa

DBGET integrated database retrieval system