KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6526Help
Entry
Bcen2424_6526     CDS       T00415                                 

Definition
(GenBank) oxidoreductase FAD/NAD(P)-binding domain protein
  KO
K05784  benzoate/toluate 1,2-dioxygenase reductase component [EC:1.18.1.-]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00362  Benzoate degradation
bch00364  Fluorobenzoate degradation
bch00622  Xylene degradation
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
bch01220  Degradation of aromatic compounds
Module
bch_M00551  Benzoate degradation, benzoate => catechol / methylbenzoate => methylcatechol
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen2424_6526
   00364 Fluorobenzoate degradation
    Bcen2424_6526
   00622 Xylene degradation
    Bcen2424_6526
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.-  
     Bcen2424_6526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Fer2 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ABK13256
Position
3:748719..749741
Genome map
AA seq 340 aa AA seqDB search
MSSYKIALNFEDGVTRFIDCKAGEKVLDAAFRAKINLPMDCADGVCGTCKCRAESGHYDL
GDDYIDDALTEDEKDGGLVLTCQMVPHSDCVIAVPTSSVACKTGQSAFAATVTKVEQHND
AAVVLELDVGASAPAFLPGQYVNIGVPGSGQHRSYSFSSAPGDTKVGFLIKKIPGGVMSR
WLESAKPGDTLELHGPLGSFYLRDVQRPLLFLAGGTGLAPFLSMLEVLARSGSQQKVHLI
YGVTRDLDLVLVDAIEAVASKLPNFSFATVVADAASNHARKGWVTQHIPADALNDGDVDV
YLCGPPPMVDAVRQYFDDAGVKPNSFHYEKFTPNVTAKAA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctacaagattgcattgaatttcgaggacggggtgacccgcttcatcgactgc
aaggccggcgagaaagtactcgacgcggccttccgcgcgaagatcaacctgccgatggat
tgcgccgacggcgtgtgcggtacctgcaagtgccgcgccgagagcgggcactacgacctc
ggtgacgattacatcgacgatgcgctgaccgaggacgaaaaggacggcggcctcgtgctg
acgtgccagatggtgccgcacagcgactgcgtgatcgcggtgccgacgtcgtcggtcgcg
tgcaagaccgggcagagcgcttttgccgcgacggtcacgaaggtcgagcagcacaacgat
gcggccgtcgtgctcgaactcgacgtcggcgcgagcgcgccggcgttcctgccgggccag
tacgtgaacatcggcgtgccgggcagtggccagcatcgctcgtattcgttctcgtccgcg
ccgggcgacacgaaggtcggattcctgatcaagaagattcccggcggggtgatgagcagg
tggctcgaatcggcgaaacccggcgacacgctcgaactgcacgggccgctcggcagcttc
tacctgcgcgacgtgcagcggccgctgctgttccttgccggcggcacgggcctcgcgccg
ttcctgtcgatgctcgaggtgctcgcgcgcagcgggtcgcagcagaaggtgcacctgatc
tacggcgtgacgcgcgatctcgatctcgtgctggtcgatgcgatcgaagcggttgcgtcg
aagctgccgaacttcagcttcgcgacggtcgttgccgatgcggcgtcgaaccacgcgcgc
aagggctgggtcacgcagcacattccggccgatgcgctgaacgacggcgacgtcgacgtg
tatctgtgcggaccgccgccgatggtcgatgcggtgcgccagtatttcgacgacgcaggc
gtgaagcctaacagcttccactacgagaagttcactcccaacgtcacggcaaaggcggca
tga

DBGET integrated database retrieval system