KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6529Help
Entry
Bcen2424_6529     CDS       T00415                                 

Definition
(GenBank) Feruloyl esterase
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tannase
Motif
Other DBs
NCBI-ProteinID: ABK13259
Position
3:751092..752939
Genome map
AA seq 615 aa AA seqDB search
MLNGRTRRGGWRFGMAVAASAAGILMVSGCNDNEVQNAGGGTADAALTCDQTMKARFAPD
ANTAVIAVKSFKAGDPLVLDASAVTSATPVAGNSLCLVKLNVGPGHAGPSAAPSTSAGIG
MEIWLPAPSNWNRRIHNLGGGGWQGGAYGDPTKIASAGATPNAATIAASEGAVVGTTDTG
HAIQNGSFAMNPDGTINTTLWNDFAQRSLHELALKTKALVAAYYATPQKYAYWDGCSTGG
RQGYNEAQNNPSDYDGYLNGAPAFNWSKFITGELYPQVVAQVDLGGVTLTDAQQSLLSGA
AVSACDTVGGQHLGYLMDPAQCRYDPTQDANVLCSGVKIGAVTGTNATAACVTAARATAM
NKTWYGMTRDGSVPNPALDIGTATSLASNQMWFGLMRGTGTGALAGATPFSISTDLVALE
LQDPTIAGAGFTNATGNGANKWKDLGYAGLANAYDQGIALQSSFGNINTDNPDLSGLVTH
GAKVLHYHGLADPLITPSGSIHYYERIASRMGGIPAVQQFDRLFLVPGMGHCSGYGGVNG
TAGPAQTANTVPLPHADRQDLYAQLVNWVENGNAPTSIKLTSADGSASQPVCMYPTKATY
NGSGSIRDAANYSCK
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacggtagaactcgtcgtggtggatggcgtttcggcatggctgtcgcggcatcc
gcggccggcatactgatggtgtccggttgcaacgacaacgaagtccagaatgccggaggc
ggcacggccgatgccgcgttgacctgcgatcagacgatgaaggcgagattcgcgccggat
gcgaacacggcggtgatcgcggtgaagtcgttcaaggcgggcgatccgctggtgctcgat
gcgtccgcggtcacgtccgcgacgcccgtcgccggcaacagcctgtgtctcgtcaagctg
aacgtcgggccgggccacgcgggcccgtcagccgcaccgtcgacgtcggccggcatcggg
atggaaatctggctgcccgcgccgtcgaactggaatcgcaggattcacaacctcggcggc
ggcgggtggcagggcggtgcgtacggcgacccgacgaagattgccagcgcgggcgcgacg
ccgaacgccgcgacgatcgcggcgtccgagggcgcggtggtaggcacgacggataccggg
cacgcgatccagaacggatcgttcgcgatgaatccggacggcacgatcaatacgacgctg
tggaacgacttcgcgcagcgcagcctgcacgaactggcgctcaagacgaaggcgctggtc
gccgcgtactacgcgacgccgcaaaagtatgcgtactgggacggctgctcgaccggcggc
cggcagggctacaacgaagcgcagaacaatccgtccgactacgacggctacctgaacggc
gcgcctgcgttcaactggtcgaagttcattacgggcgagctgtatccgcaggtcgtcgcg
caggtcgatctcggcggcgtgacgctgacggatgcgcagcagtcgctgctgtcgggggcg
gcggtcagcgcgtgcgacacggtcggcggccagcatctcggttacctgatggacccggcc
cagtgtcgttacgatccgacccaggacgcgaacgtactgtgctcgggcgtgaagatcggc
gccgtcaccggcacgaacgcgacggccgcgtgcgtgacggccgcgcgggccaccgcgatg
aacaagacctggtacgggatgacgcgcgatggctcggtgccgaatccggcgctcgacatc
ggcacggcgacgtcgctcgccagcaaccagatgtggttcgggctgatgcgcggcacgggc
accggcgcgctggccggcgcgactccgttcagcatctcgaccgacctcgtcgcgctggag
ctgcaggacccgacgatcgccggcgccggcttcacgaacgcgaccggcaacggcgcgaac
aagtggaaggacctcggctatgcgggtctcgcgaacgcctatgaccaggggatcgcgctg
cagtcgtcgttcggcaacatcaacaccgataacccggacctgtcggggctcgtgacgcac
ggtgcgaaggtgctgcattaccacggtcttgccgatccgctgatcacgccgtcgggcagc
atccactactacgaacgcatcgcgagccggatgggtggcataccggcggtgcagcagttc
gaccggctgttcctcgtgccgggcatggggcattgcagcggctatggcggtgtcaacggc
acggccggcccggcgcaaacggccaatacggtgccgttgccgcatgccgaccggcaggac
ctgtatgcgcagttggtcaactgggtcgaaaacggcaacgcgcccacgagcatcaagctg
acgtcggcggacggcagcgcgagccagcccgtgtgcatgtatccgacgaaggcgacgtac
aacggttcgggatcgatccgggacgcggcgaactattcgtgcaaatga

DBGET integrated database retrieval system