KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6544Help
Entry
Bcen2424_6544     CDS       T00415                                 

Definition
(GenBank) transport-associated protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BON YtxH
Motif
Other DBs
NCBI-ProteinID: ABK13274
Position
3:771214..771624
Genome map
AA seq 136 aa AA seqDB search
MYFLDPASGRRRRAYLRDKAVAGRHDVADYANTQVKRAADHARGAIVGLRADWLAGDASD
VQVAERVRAALGRLVARPRDIDVSVERGNVCLTGQVEEAERQALIDGVAALHGVHHVEDA
MGARSEYKASPDGHSQ
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgtacttcctcgatccggcgtccggccggcgccgacgcgcttatctgcgcgacaaggcg
gttgcgggccggcacgacgtggccgattatgcgaatacgcaggtgaagcgggcggccgac
catgcgcgcggcgcgatcgtcggcctgcgggcggactggctcgcgggcgatgcgagcgac
gtgcaggtggccgagcgcgtgcgcgcggcgctcggccggctcgtcgcccgcccgcgcgac
atcgacgtgagcgtcgagcgcggcaacgtgtgcttgaccggacaggtcgaggaagccgaa
cgtcaggcgctgatcgacggcgtcgccgcgctgcatggcgtgcatcacgtcgaggacgcg
atgggcgcgcgcagcgagtacaaggcgtcgcccgacggtcattcgcagtga

DBGET integrated database retrieval system