KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6553Help
Entry
Bcen2424_6553     CDS       T00415                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_8 DUF4440
Motif
Other DBs
NCBI-ProteinID: ABK13283
Position
3:complement(779990..780556)
Genome map
AA seq 188 aa AA seqDB search
MERPMTFSAVPPVSSPPVLDTPRLILEGHPLGDFDALAAMWAEPGVVAHIFNGTPSTPRD
SWMRMLAYRGLWPLLGYGYWAIREKASGRYVGDLGFADFHRNIKPPIRGVPEAGWALATW
AQGNGYATEALAAALAWLDAQQRFERSVCLIAPTNVASIRVAEKAGYGEPRRIRFNDADS
LMFSRKSR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcccgatgacattcagcgccgtgccccccgtctcgtccccgcccgttctcgac
acgccgcgcctgattctcgaaggccatccgctcggcgacttcgacgcactcgccgcgatg
tgggcggagcccggcgtcgtcgcgcacatcttcaacggcacgccctccacaccgcgcgac
tcgtggatgcgcatgctcgcgtatcgcgggctgtggccgctgctcggctatggctactgg
gcgattcgcgaaaaggcgtcgggccgttatgtcggcgatctcggcttcgcggattttcat
cggaacatcaagccgccgattcgcggcgtgccggaagccggctgggcgctggcgacgtgg
gcgcaaggcaacggctacgcgaccgaggcgctcgcggccgcgctcgcatggctcgacgca
cagcagcggttcgagcgcagcgtgtgcctgatcgcgccgaccaacgtcgcctcgatccgg
gtcgcggagaaagccggttacggcgagccgcggcgcatccgcttcaacgacgccgattcg
ctgatgttctcgcgcaagagccggtaa

DBGET integrated database retrieval system