KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6556Help
Entry
Bcen2424_6556     CDS       T00415                                 

Definition
(GenBank) alkylphosphonate utilization operon protein PhnA
  KO
K06193  protein PhnA
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bch00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Bcen2424_6556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnA PhnA_Zn_Ribbon OrfB_Zn_ribbon UPF0547
Motif
Other DBs
NCBI-ProteinID: ABK13286
Position
3:781591..781944
Genome map
AA seq 117 aa AA seqDB search
MEAAMNAPACPQCAMENTYPDGALTVCADCGHEWSADAGAEAGDEPAGDVVKDANGNVLS
DGDSVVLIKDLRVKGSSITLKMGTKVKSIRLVGGDHEVDCKTDMGGFMLKACYLKKV
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcaatgaatgcccccgcctgcccgcaatgcgcgatggaaaacacttacccg
gatggcgcactgaccgtgtgcgcggactgcggccatgaatggtcggccgacgccggcgcc
gaggccggcgacgaaccggcgggcgacgtcgtcaaggacgccaacggcaacgtgctgtcg
gacggcgattcggtcgtgctgatcaaggacctgcgcgtgaagggttcgtcgatcacgctg
aaaatgggcaccaaggtcaagagcatccggctcgtcggcggcgatcatgaagtcgactgc
aagaccgacatgggcggcttcatgctgaaggcgtgctatctgaagaaggtctga

DBGET integrated database retrieval system