KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6558Help
Entry
Bcen2424_6558     CDS       T00415                                 

Definition
(GenBank) CopG domain protein DNA-binding domain protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1 RepB-RCR_reg RHH_5 Slx4 SelB-wing_3 TERF2_RBM
Motif
Other DBs
NCBI-ProteinID: ABK13288
Position
3:complement(782914..783099)
Genome map
AA seq 61 aa AA seqDB search
METKTARLTVLIDPAKKEAFEMLCAEQDLTPSQVVRQLIREYLDRHGVTYKTRSAIGKRV
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaaaccgcccgcctgaccgtcctgatcgatcccgcgaagaaggaagccttc
gagatgctctgcgcggagcaggatcttacgccgtcgcaagtcgtccggcagttgatccgc
gaatatctcgaccggcacggcgtcacgtacaagacccgcagcgcgatcggcaagcgcgtg
aagtaa

DBGET integrated database retrieval system