KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6561Help
Entry
Bcen2424_6561     CDS       T00415                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2909 DUF1772
Motif
Other DBs
NCBI-ProteinID: ABK13291
Position
3:784544..784756
Genome map
AA seq 70 aa AA seqDB search
MKTLLVSVAFAMIIASLIFALYFMNHDRGKSKRMAWSLAARVGLSVTLFLSLLIAYKLGW
IEPTGLPIGR
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccctgctggtttctgtggcattcgcgatgatcatcgcgagcctgatcttcgcg
ctgtacttcatgaatcacgatcgcggcaaatccaagcggatggcgtggtcgctcgccgcg
cgcgtcggcttgtcggtcacgctgttcctgtcgctgctgatcgcgtacaagctcggctgg
atcgagccgaccgggttgccgatcgggcgctga

DBGET integrated database retrieval system