KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6567Help
Entry
Bcen2424_6567     CDS       T00415                                 

Definition
(GenBank) luciferase family protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: ABK13297
Position
3:complement(790800..791969)
Genome map
AA seq 389 aa AA seqDB search
MTFDALRSHFDLSALSALPFRLSVLDKSPVAPGETAADALARSVSLARFADAAGYHRYWL
AEHHNTAALACPSPEIVIAHVLAHTRRIRVGSGGVMLQHYSPYKIAENFNLLASLAPGRV
DLGIGKAPGGLPLSTRALQAGYDPARRASFADLADELNRHLKGDDATADAAGQDGGATLH
ATPRPPVPAQPFLLGASAESATLAARLGWAFVYASHLNASATDLERTFDTYREASGGRTP
LLAVSAIVADTRDAAAQLASGHQGFRVQVGDTPAVNVGSLEQAHAYIRQAGGGPHRIEPR
ETRIVHGTRDDVLRELDALHRRHGIAEFVVDTPVADAAPRIASLRLLAGVPADDDHDTAA
ARGTLGGSNARAPHARTTTHQPDFEGTAP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgacgccctccgttcccacttcgatttgtccgctttgtccgcgctgccgttc
cgcttgagcgtgctcgacaagagccccgtcgcacccggagaaaccgccgccgacgcactg
gcgcgcagcgtatcgctcgcacgcttcgccgatgcggccggctatcaccgctactggctc
gccgaacatcacaacaccgccgcgctcgcatgcccgtcgccggaaatcgtgatcgcccac
gtgctcgcgcatacgcggcgcattcgggtcggatcgggcggcgtgatgctgcagcactac
agtccgtacaagatcgcggaaaatttcaacctgctcgcgtcgctcgcacccggccgcgtc
gacctcggcatcggtaaggcgccgggcggcctgccgctgtcgacccgtgcgctgcaggcc
ggctacgatccggcgcggcgcgcgtctttcgccgacctggccgacgagctgaatcgccat
ctcaagggtgacgatgcgacagccgatgcagccggccaggatggcggcgccacgctgcat
gcgacgccacgcccgccggtgcccgcgcaaccgttcctgctcggcgcgagcgcggaaagc
gccacgctcgccgcgcggctcggctgggcgttcgtctacgcgtcgcacctgaatgcctcc
gcgacggatctggaacgcacgttcgacacctatcgcgaagcgtcgggtggccgcacgccg
ctgctggccgtctccgcgatcgtcgccgacacccgcgacgcggcggcgcagctcgcgagc
ggacatcagggttttcgcgtgcaggtaggcgacacgcccgccgtcaacgtcggcagcctc
gaacaggcgcatgcatacatccgccaggccggcggcggcccgcaccggatcgaaccgcgc
gaaacacggatcgtgcacggcacgcgcgacgacgtgctgcgcgagctcgacgcattgcat
cgtcgtcacgggattgccgaattcgtcgtcgacacgccggtcgccgatgccgcgccgcgg
attgcgtcgctgcggttgctcgccggcgtacctgccgacgacgatcacgacaccgcggcg
gcgcgcggcacgctcggcgggtcgaacgcgcgagccccgcacgcgcgcacgaccacgcat
caaccggacttcgaaggcaccgcgccatga

DBGET integrated database retrieval system