KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6569Help
Entry
Bcen2424_6569     CDS       T00415                                 

Definition
(GenBank) putative monooxygenase
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: ABK13299
Position
3:792302..793609
Genome map
AA seq 435 aa AA seqDB search
MSGARRRLKTLVGAASVLYAPGDADVAQGVRRAASLARKAEAEKITGLFTADLLQADAAG
LAGTTGSQEPIVALAALSQATSAIGLVATVSTTYHHPYNLARLIGTLDHVSGGRAAWNAV
TSSVGEENFGDAALPDPEQRYARAAEFVEVVNALFDANDPRATRRGPGGGISVDPLKLGA
IDYRGAHFQVQGPLNVPPSPQRRPVLFQAGQSASGVALGARYAEVVYTSQPTLDDARLFV
AELHRQAAAFGRGDRPPLVMNSFHSVIGESDADVARRLRDKHERIDYEQGRLKLADMLGG
GVDLSGLPLDQPLPSSLLPAIDSVHRRRGRVAIFVGYARQRLTLRELIIRAQETGHWFVA
GTPEQLADAIETRYRAGLVDVLSLHGLGQPDQEDLLLNGLLPELRRRDLLDTDYVGGDFR
ANLELPALRREAVAA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgcacgcagacggctgaagacgctcgtcggcgcggcgagcgtgctctacgcg
cccggcgatgcggatgtcgcacagggcgtgcggcgcgcggcgtcgctcgcgcgcaaggcg
gaagccgagaagatcaccggcctctttaccgccgacctgttgcaggccgatgcggcgggc
ctcgccgggaccaccggcagccaggagccgatcgtcgcgctggcggcgctgagccaggcg
acatcggccatcgggctcgtcgcgacggtgtcgaccacgtatcaccatccatacaacctc
gcacggctgatcggcacgctcgatcacgtgagcggcggccgcgccgcgtggaatgcggtc
acgtcgtcggtcggcgaggagaatttcggcgatgccgcgttgcccgacccggagcagcgt
tatgcgcgcgcggccgaattcgtcgaagtcgtcaacgcgctgttcgacgcgaacgatccg
cgcgcgacgcggcgcgggccgggcggcggcatctcggtcgatccgttgaagctcggcgcg
atcgactatcgcggcgcgcatttccaggtgcaggggccgctgaacgtgccgccgtcgccg
caacggcggccggtgctgttccaggcggggcagtcggcaagcggcgtggcgctcggcgcg
cgctatgcggaagtcgtctacacgtcgcagccgacgctcgacgatgcgcgcctgttcgtc
gccgagctgcaccggcaggcggccgcattcggtcgcggcgaccggccgccgctcgtgatg
aactcgtttcattcggtgatcggcgaatccgatgccgacgtcgcgcggcgcttgcgcgac
aagcatgaacgcatcgattacgaacaaggcaggctgaagctcgccgacatgctgggcggc
ggcgtcgacctgagcggcctgccgctcgaccagccgttgccgtcatcgctgctgccggcg
atcgacagcgtgcaccgccggcgcggacgcgtggcgatcttcgtcggctacgcgcgccag
cggctgacgctgcgcgagctgatcatccgcgcgcaggagaccggccactggttcgtcgcc
ggcacgccggagcagctcgccgacgcgatcgagacgcgttatcgcgcggggctcgtcgac
gtgctgtcgctgcacgggctcggccagccggaccaggaggacctgctgctcaacggcttg
ctgcccgaattgcggcggcgcgatttgctcgataccgactatgtgggcggcgatttccgc
gcgaatctggaactgccggcgttgcggcgcgaggccgtggcggcgtga

DBGET integrated database retrieval system