KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6579Help
Entry
Bcen2424_6579     CDS       T00415                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase
Motif
Other DBs
NCBI-ProteinID: ABK13309
Position
3:803257..804222
Genome map
AA seq 321 aa AA seqDB search
MTSRQHPLHSGFDAASTASDVLAGLDLHGKTAIVTGGHSGLGLETTRALAQAGAHVVVGA
RSAAAAREATRGIAGVEVAPLELADAASVAAFAARFVDAGRHVHIVINSAGIMACPETRL
GDGREAQLAVNHLGHYALVNRLWPVLAHGDGARVVAVSSLGHRLSPIRWDDIDFARGYDK
WLAYGQSKTANALFAVQLDMLGAPFGVRAYSLHPGKIATPLQRHLTREEMMAQGWVDEHG
VPIDPTFKTPAQGAATQVWAATSPRLADLGGVYCEDCDVAAVTRGNEESGVRPHAIDPEE
AARLWAWSAAATGVDAFAARG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcaggcagcatccccttcattccggattcgacgccgcctcgacggcgagcgac
gtcctggccggcctcgatctgcacggcaagaccgccatcgtcacgggcggccattcgggt
ctcggcctcgaaaccacgcgggcactggcgcaggccggtgcgcacgtcgtcgtcggcgca
cggagcgccgcggccgcgcgcgaagcgacgcgcggcatcgcgggcgtggaggtcgcgccg
ctcgaactcgcggacgccgcgagcgtggccgcattcgccgcgcggttcgtcgatgcggga
cgccacgtgcatatcgtcatcaacagcgcgggcatcatggcgtgcccggagactcgcttg
ggcgacggtcgggaagcgcagttggccgtcaatcacctcggtcactacgcgctcgtcaac
cggctgtggcccgtgctcgcgcatggcgacggcgcccgcgtggtggcggtgtcgtcgctc
gggcaccggctgtcgccgattcgctgggacgatatcgatttcgcgcgcggttacgacaaa
tggctcgcgtacgggcagtcgaaaaccgccaatgcgttgttcgcggtgcagctcgacatg
ctcggcgcgccgttcggcgtccgcgcgtattcgctgcatccgggcaagatcgcgacgccg
ctgcagcgtcatttgacgcgcgaggaaatgatggcgcagggctgggtcgacgaacacggc
gtgccgatcgatccgacgttcaagacgcccgcgcagggagcggcaacgcaggtatgggcg
gcgacgtcgccgcgcctggccgatctcggcggtgtctattgcgaggattgcgatgttgcg
gcggtgacccgcggcaacgaggaatcgggcgtgcgcccgcacgcgatcgatccggaggag
gcggcgcggctgtgggcgtggtccgcggcagcgacgggcgtcgatgcctttgcggcgcgg
ggctga

DBGET integrated database retrieval system