KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6585Help
Entry
Bcen2424_6585     CDS       T00415                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABK13315
Position
3:808602..808883
Genome map
AA seq 93 aa AA seqDB search
MTQDSQRQDPASPDAARETADTPERRNPTRGGESTARPGHAPGGGELDSIPDDQARKVVP
DDSRQTEVHDPAGKPWPDEHDAPDDSGNRPRPL
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggacagtcaacgacaggaccccgcgtcgcccgacgcggcgcgcgagacggcc
gacacgccggagcggcgtaacccgacccgtggcggcgaatcgactgcgcgccctggccat
gcgcccggcggcggcgagctcgattcgattcccgacgatcaggcgcgcaaggtggtgccg
gacgactcgcgccagaccgaggtccacgatccggccggcaagccgtggccggacgagcac
gatgcgcccgacgattcgggcaaccggccgcggccgctgtag

DBGET integrated database retrieval system