KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6588Help
Entry
Bcen2424_6588     CDS       T00415                                 

Definition
(GenBank) ABC transporter substrate binding protein
  KO
K02051  NitT/TauT family transport system substrate-binding protein
Organism
bch  Burkholderia cenocepacia HI2424
Module
bch_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bch02000]
    Bcen2424_6588
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Bcen2424_6588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1_2 NMT1 OpuAC Lipoprotein_9 K-cyclin_vir_C
Motif
Other DBs
NCBI-ProteinID: ABK13318
Position
3:811148..812179
Genome map
AA seq 343 aa AA seqDB search
MSFSFLPARRALAATLTAALAFAGAVIPQAAHAEGRIRIAEQFGVVYLMLNVARDQQLIE
KEGRKAGLDIKVDWVRLSGGAAVNDALLSGAVDIAGAGVGPLLTVWDRTRGRQNVKGVAS
LGNFPYYLVSSNPNVKTIADLSAKDRIAVPAVGVSVQSRVLQYAAAKQWGDKQFDKLDPL
TQAIPHPDATAAILANSNVITGHFGNPPFQEQELAGNPNAHIVLNSYDVLGGPSSATVLY
ATEKFRDDNPKTYRAFVAALADAARQIAADPERAADTYIRVNGSKIDRALLLKILRNPQV
QFKTAPQNTLPLAQFMHRTGAIRNEPKSWRDYFFDDPATAGGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcgttcttgccggcgcgtcgtgcgctggcggccacgctcaccgccgcactc
gccttcgccggcgcggtcatcccgcaagccgcgcacgcggaaggccgcatccgcatcgcc
gagcagttcggcgtcgtctacctgatgctgaacgtcgcgcgcgaccagcaactgatcgag
aaggaagggcgcaaggccggcctcgacatcaaggtcgactgggtgcggctgtcgggcgga
gcggccgtgaacgacgcgctgctgtccggcgcggtggacatcgcgggcgcgggcgtcggg
ccgctgttgaccgtgtgggaccgcacgcgcggccggcagaacgtgaagggcgtcgcgtcg
ctcggcaattttccgtactacctcgtgagcagcaacccgaacgtgaagacgatcgccgac
ctgagcgcgaaggaccgcatcgcggtgccggcggtcggcgtgtcggtgcagtcgcgcgtg
ctgcagtacgcggcggcgaagcagtggggcgacaagcagttcgacaagctcgacccgctc
acgcaggcgattccgcatccggacgcgacggccgcgattctcgcgaacagcaacgtgatc
accggccacttcggcaatccgccgttccaggagcaggaactcgccggcaatccgaacgcg
cacatcgtgctgaattcgtatgacgtgctcggcggcccgagctccgcgacggtgctgtac
gcgactgagaagttccgcgacgacaacccgaagacctaccgggcgttcgtcgccgcgctg
gccgacgccgcccggcagatcgcggccgatccggaacgcgcggccgatacctatattcgc
gtgaacgggtcgaagatcgatcgcgcgctgctgctgaagatcctgcgcaatccgcaggtg
cagttcaagaccgcgccgcagaacacgctgccgctcgcgcagttcatgcatcgcaccggc
gcgatccgcaacgaaccgaagtcgtggcgcgactacttcttcgacgatccggcgacggcc
ggcggcagttga

DBGET integrated database retrieval system