KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6590Help
Entry
Bcen2424_6590     CDS       T00415                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02050  NitT/TauT family transport system permease protein
Organism
bch  Burkholderia cenocepacia HI2424
Module
bch_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bch02000]
    Bcen2424_6590
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Bcen2424_6590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABK13320
Position
3:813250..814137
Genome map
AA seq 295 aa AA seqDB search
MSTIDPAVPPLPPVRAEYTRTLDTLPDAERAAPAPLLRRIAGAAWFRRSVIALVLIAAWE
IVARIVANDLLVPTFGATLAAFVQGVESGELLVKTGISMSVLLRGYALGVLLAFALTSLA
VSTRIGRDLLTMLTSMFNPLPSIALLPIALLWFGLGTGSLLFVLVHAVLWPLALSIYTGF
VGVPATLKMAGRNYGLTGLRQIALILVPAALPSILSGLRVGWAFAWRTLIAAELVFGASA
GQGGLGWYIFQNRNELYTDRVFAGLAAVIVIGLLVENLVFDTLERATVRRWGIQH
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgatcgatccggccgtgccgccgctgccgcccgtgcgcgccgaatacacgcgc
acgctcgacacgctgcccgacgccgagcgtgcggcgcccgcgccgctgctgcgccgcatc
gccggcgccgcctggtttcgccgcagcgtcatcgcgctcgtgctgatcgccgcatgggaa
atcgtcgcgcgcatcgtcgcgaacgatctgctcgtcccgaccttcggcgcgacgctggcc
gcgttcgtgcagggcgtcgagtcgggcgaactgctggtcaagaccggcatctcgatgtcg
gtgctgctgcgcggctatgcgctgggcgtgctgctggcgttcgcgctgacgtcgctggcg
gtatccacgcgcatcggccgcgacctgctgacgatgctcacgtcgatgttcaatccgctg
ccgtcgatcgcattgctgccgatcgcgctgttgtggttcgggctcggcaccggcagcctg
ctgttcgtgctcgtgcatgcggtgctgtggccgctcgcgctcagcatctataccggcttc
gtcggcgtgcccgccacgctgaaaatggccgggcgcaactacgggctcacgggcctgcgc
cagatcgcgctgatcctcgtgccggccgcgctgccgtcgatcctgtcgggcctgcgcgtg
ggctgggccttcgcgtggcgcacgctgatcgcggccgagctcgtgttcggcgcgagcgcg
gggcagggcggcctcggctggtacatcttccagaaccgcaacgagctgtataccgaccgc
gtgttcgcgggcctcgcggcggtcatcgtgatcgggctgctggtcgagaatctggtgttc
gatacgctcgaacgcgcgaccgtgcgtcgctggggcattcagcactga

DBGET integrated database retrieval system