KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6594Help
Entry
Bcen2424_6594     CDS       T00415                                 

Definition
(GenBank) oxidoreductase, molybdopterin binding protein
  KO
K17225  sulfane dehydrogenase subunit SoxC
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00920  Sulfur metabolism
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Bcen2424_6594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_molyb Mo-co_dimer BNR
Motif
Other DBs
NCBI-ProteinID: ABK13324
Position
3:complement(817343..818599)
Genome map
AA seq 418 aa AA seqDB search
MTDSRFPPRAPRNGRRAALRQLAGGWVAAMLPASGALASEPLDVPPWTRTPGAPLLSPPY
GVPGQHERDVIRRSARTPALPGSGSSMTPLADLFGDITPNGLVYERHHAGVPDIDAQRHR
VVVHGLVREPRVFTLDDLLRFPSESRIHFLECSGNTGSEWNGPSGLPVQFTHGLLSCCEW
TGVRLSTLLDETGVDADARWLLAEGADGAAMTRSLPLDRILERALVVYAQNGERLRPENG
YPVRLIVPGFEGNTNIKWLRRLKLVRAPEMTREETSKYTNLLPDGCARQFVFEMDAKSVI
TRPSAGHRLAAHGYYPISGYAWSGRGRIRAVDVSTDGGRTWRPARLAGDVRDRALTRFEA
DWVWRGEPADLQSRATDETGYVQPTRDALVAARGLNSQYHYNGIQNWRVGTDGEVRNA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcccgttttcctccccgtgcgccgcgaaacggccggcgcgcggcgctgcgc
cagctcgccggcggctgggtggccgcgatgctgcccgccagcggtgcgctcgcgagcgag
ccgctcgatgtgccgccgtggacgcgcacgcccggtgcgccgctgctgtcgccgccctac
ggcgtgccaggtcagcacgagcgcgacgtgattcgccgcagcgcccgaacgcctgcgctg
cccggttccggctcgtcgatgacgccgctcgccgacctgttcggcgacatcacgccgaac
gggctcgtctacgagcgtcatcacgcgggggtgccggacatcgatgcgcaacgccatcgc
gtcgtcgtgcacggcctcgtgcgcgagccgcgcgtcttcacgctcgacgacctgctgcgc
tttccgtccgaatcgcgcattcacttcctcgaatgctcgggcaacacgggcagcgaatgg
aacggcccgagcgggctgccggttcagttcacgcacgggttgctatcgtgctgcgaatgg
accggcgtccggctgtcgacgctgctcgacgagacaggcgtcgacgccgacgcccgctgg
ctgctcgccgagggcgcggacggcgcggcgatgacgcgcagcctgccgctcgaccggatt
ctcgagcgcgcgctggtcgtctatgcgcagaacggcgaacggctgcgcccggagaacggc
tacccggtgcggctgatcgtgccgggtttcgaaggcaacacgaacatcaagtggctgcgg
cggctgaagctggtgcgtgcgccggagatgacgcgcgaggaaacgtcgaagtacacgaat
ctgctgccggatggctgcgcgcgccagttcgtgttcgagatggatgcaaagtcggtcatc
acgcggccgtcggccggccatcggctcgccgcgcacggctactacccgatcagcggctac
gcgtggtcgggccgtggccggattcgcgccgtcgacgtgtcgaccgacggcggccgcacg
tggcgaccggcgcggctcgccggcgacgtacgcgatcgtgcgctgacgcgcttcgaagcc
gactgggtgtggcgcggcgagccggccgacctgcaaagccgggcgaccgacgagaccggc
tacgtgcagccgacccgcgacgcgctcgtcgccgcgcggggcctgaactcgcagtatcac
tacaacggcatccagaactggcgcgtcggcacggacggcgaggtgcgcaatgcgtaa

DBGET integrated database retrieval system