KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6595Help
Entry
Bcen2424_6595     CDS       T00415                                 

Definition
(GenBank) porin, Gram-negative type
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_4 Porin_1
Motif
Other DBs
NCBI-ProteinID: ABK13325
Position
3:complement(818730..819914)
Genome map
AA seq 394 aa AA seqDB search
MIKKTVVLGLVSIGSVSAQAQSSVTLYGVVDAGIAYTNNQGGASNIQQTSGKLSGSRWGL
KGAEDLGGGLQAVFTLESGFRPSDGGLGQGGRLFGRSAYVGLGQKGLGTLTFGRQYEPIT
DLVAQYSGAGFWSPATHVGDNDNLNQSFRLNNAVKFRSDTIAGFTADLLYAFSNQANGGA
GTGFSNNNAWGASANYVNGPLSIGGGYVRFNHPNAASNTSGAVGGATSTTGNDYSGAFFY
GLNGGVLKQQIGAVGANYALGPATLGFAWSHTQLNYLDGSSRKFNNYDVNARYQITPAAT
LIGVYTFTDGRASGLPGTSGQTLKPRWHQFTLGFDYALSKRTDIYVSGIYQLAAGDASTA
TSGGYRKIAAISNIGSASSTNRQLAFVSGLRVKF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaacggtggtactgggtttggtgtcgatcggttcggtcagcgcgcaggcg
cagagttcggtgacgttgtacggcgtggtcgacgccggcatcgcgtacacgaacaaccag
ggcggcgcgagcaacatccagcagacgagcggcaagctgagcggcagccgctggggcctg
aaaggcgcggaagatctcggcggcggcctgcaggcggtcttcacgctggaaagcgggttc
cggccgagcgacggcgggctcggccagggcggccgcctgttcggccggtccgcgtacgtg
ggcctcggccagaaaggcctcggcacgctgacgttcggccgtcagtacgagccgatcacc
gatctcgtcgcgcagtattcgggagcgggtttctggtcgccggccacgcacgtgggcgac
aacgacaacctgaaccagagcttccggctgaacaacgcggtgaagttccgcagcgacacg
atcgccggcttcaccgccgacctgctctatgcgttcagcaaccaggccaatggcggcgcg
ggcactggattctcgaacaacaacgcgtggggtgcatcggcgaactacgtgaacggcccg
ctgtcgatcggcggcggctatgtgcggttcaatcatccgaatgcggcgtcgaataccagc
ggcgcggtgggcggcgcaacctcgaccaccggcaacgactacagcggcgcgttcttctac
gggctgaacggcggcgtgctgaagcagcagatcggcgcggtgggcgcgaactacgcgctc
ggccccgcgacgctcggcttcgcatggagccacacgcagctcaactatctcgacggttcg
tcgcgcaagttcaacaactacgacgtgaacgcgcgctaccagatcacgccggcggccacg
ctgatcggcgtctatacgtttaccgacggacgcgcgagcggcctgccgggcacgagcggc
cagacgctgaagccgcgctggcaccagttcacgctcgggttcgactatgcgctgtcgaag
cgcaccgatatctatgtgtcgggcatctaccagctcgcggccggcgacgcgagcaccgcg
acgtcgggcggctatcgcaagatcgcggcgatctcgaacatcggcagcgcgtcgtcgacg
aaccgccagcttgcgttcgtcagcgggctgcgcgtgaagttctga

DBGET integrated database retrieval system