KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6597Help
Entry
Bcen2424_6597     CDS       T00415                                 

Definition
(GenBank) ABC nitrate/sulfonate/bicarbonate transporter, periplasmic ligand binding protein
  KO
K15553  sulfonate transport system substrate-binding protein
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00920  Sulfur metabolism
bch02010  ABC transporters
Module
bch_M00436  Sulfonate transport system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Bcen2424_6597
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bcen2424_6597
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bch02000]
    Bcen2424_6597
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfonate transporter [MD:M00436]
    Bcen2424_6597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1 Phosphonate-bd SBP_bac_3 NMT1_3 Pyocin_S
Motif
Other DBs
NCBI-ProteinID: ABK13327
Position
3:820796..821785
Genome map
AA seq 329 aa AA seqDB search
MSSMSAARRRLLLAGAAIAAHPLAAFAAPAADADLAGTTLRVATYKGGWRALLQAAGLAD
MPYRIDWRELNNGVLHIEALNADALDIGSGSEIPAVFAARQKANVRFISRVREDLNNQVT
LARKDTPIRGIADLKGKRVGYVRATTSHYFLYRQLAEAGLTFDDIQPINLSPTDGLSAYD
RGDIDAWAIYGYNGQLARNRYDARVLKTGKGYLSGNFPVYANPRTLDDARRRAATGDLLL
RFRRAYAWANGHFRDYALAQNRETRVPVADLVAMFDQRSEDFALLPVTPDVVAQHQQVAD
VFARIGVLDGPAHVAPFWDTSFNPLVAAG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatgtcggcggcacgtcgccgcctgctgcttgccggcgccgccatcgcggcg
cacccattggccgcgttcgccgcgccggccgccgacgccgatctggccggcacgacgttg
cgcgtcgcgacctacaagggcggttggcgcgcgctgttgcaggcggccgggctcgccgac
atgccgtaccggatcgactggcgcgaactgaacaacggcgtgctgcatatcgaggcactc
aacgcggacgcgctcgatatcggttcgggtagcgaaattccggccgtgttcgccgcgcgc
cagaaggccaacgtgcgattcatctcgcgcgtgcgcgaagacctgaacaaccaggtcacg
ctcgcgcgcaaggacacgccgatccgcggcatcgcggatctgaagggcaagcgcgtcggc
tacgtgcgcgcgacgacgtcgcactatttcctgtatcgacagctggcggaagccggcctg
accttcgacgacatccagccgatcaacctgtcgccgaccgacgggctgtccgcgtacgat
cgcggcgacatcgatgcgtgggcgatctacggctacaacggccagctcgcgcgcaatcgc
tacgacgcccgtgtgctgaagacggggaaggggtatctgtcgggcaattttccggtgtac
gcgaatccgcgcacgctcgacgatgcgcgtcgccgcgcggcgacgggcgatctgctgctg
cggtttcgacgtgcgtatgcgtgggcgaacgggcatttccgcgactatgcgctcgcgcag
aatcgcgagacgcgtgtgccggttgccgatctcgtcgcgatgttcgaccagcgcagcgaa
gacttcgcgctgctgccggtgacgcccgacgtggtcgcgcagcaccagcaggtcgcggac
gtgtttgcccgcatcggcgtgctggacgggccggcccatgtcgcgccgttctgggacacg
tcgttcaatccgctggttgcggcggggtga

DBGET integrated database retrieval system