KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6599Help
Entry
Bcen2424_6599     CDS       T00415                                 

Definition
(GenBank) ZmpA -like peptidase, Metallo peptidase, MEROPS family M04
  KO
K20273  zinc metalloprotease ZmpA
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bch00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bcen2424_6599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bch01002]
    Bcen2424_6599
Peptidases [BR:bch01002]
 Metallo Peptidases
  Family M4: thermolysin family
   Bcen2424_6599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ABK13329
Position
3:complement(823117..824814)
Genome map
AA seq 565 aa AA seqDB search
MKKLSRLLPITAITVASFSAFAQAGDQPAAVDKALQLIQQNPAAFSVAVSGTARTLKFAG
PQAAAPTDGDQFQVRDVIVDPDGTEHVRFDRFHAGLPVIGGDVVVHSSKGQLKQASVTQL
APINLAGTIGKVGNRAVVRNAPDVGATRARHIAAARFNSDVRRVDDAELVVFARDVTPTL
AYAVRVYGKATDTHGDAVLYYVDARTGTVLDAQDLIKTAAATGTGRSLYYGNLTLTTDQT
GTNAYRMLDPGRGGGSVYDGRGLSSDEVEQATDLPIFTSSTNVWGNNTTTDRQTVAADID
YGLALTWDYYKTTHNRNGIFNDGRGVKSYAHVVFNTGSGTTGANAAWLSSRVMAYGDGEP
GTRLPKPVVSVDVAGHEMSHGVTEATANLNYSGDAGGLNESTSDIFGTLVKFYANNPNDP
GNYVIGARVVSGGLRKMYKQDLDGRSFSCYPSGGFSWSNPRHDPHFSSGVGNRFFYLLSE
GPSVPSTDTGLSRAQLVCNGDTTFSGLGRDKAGKIWYRTLTVYLNANSSYPNARRASIQA
ANDLYGANSAESATVARAWSAVGVN
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactgtctcggctgctgcctatcaccgcgattaccgtcgcgagtttcagcgct
tttgcccaggccggcgaccagccggccgcggtcgacaaggcactgcaactgatccagcag
aacccggccgccttcagcgtggccgtcagcggcacggcacgcacgttgaagttcgcgggg
ccgcaagcagccgcaccgaccgacggcgatcagttccaggtacgtgacgtgatcgtcgat
cccgacggcaccgagcacgtgcgtttcgaccggttccatgcgggcctgcccgtgataggc
ggcgacgtggtcgtccattcgagcaaggggcaactgaagcaggccagcgtgacccagctc
gcgccgatcaacctcgccggcacgatcggcaaggtcgggaaccgcgccgtggtacgcaac
gcacccgacgtgggcgcgacgcgcgcgagacacatcgcggccgcgcgcttcaactcggac
gtgcgccgcgtcgacgacgccgagctggtcgtgttcgcacgcgacgtcacgccgacgctg
gcctacgcggtacgcgtctacggcaaggcaaccgacacgcatggcgacgccgtgctgtac
tacgttgacgcacgcaccggcaccgtgctcgacgcacaggacctgatcaagaccgccgcc
gcgaccggcaccggccgctcgctgtactacggcaacctgacgctcacgacggaccagacc
ggcacgaacgcataccggatgctcgacccgggccgcggcggcggctcggtctacgatggt
cgtggtctcagctcggacgaagtcgagcaagcgaccgacctgccgatcttcacgagcagc
acgaacgtgtggggcaacaacacgaccaccgaccggcagaccgtcgcggcagacatcgac
tacgggctggcattgacttgggactactacaagaccacgcacaaccgcaacggcatcttc
aacgacggccgcggcgtgaagagctacgcgcacgtggtgttcaataccggcagcggcacg
acgggcgcgaacgcggcatggctgtcgtcgcgcgtgatggcatacggcgacggcgaacct
ggcacgcgcctgccgaaacccgtggtatcggtcgacgtcgccgggcacgagatgagccac
ggcgtgaccgaagccaccgccaacctgaactattcgggtgacgcgggcggcctgaacgaa
tcgacgtccgacatcttcggcacgctcgtgaagttctacgcgaacaacccgaacgatccc
ggcaactacgtgatcggtgcacgcgtggtgagcggcggcctgcgcaagatgtacaagcag
gacctcgacggccggtcgttcagctgctacccgtccggcggcttctcgtggtcgaatccg
cgccacgatccgcatttctcgtcgggggtcggcaaccgcttcttctatctgctgtcggaa
ggcccatcggtgccgtcgaccgacaccggcctgtcgagagcgcaactggtctgcaacggc
gacacgaccttcagcgggctgggtcgcgacaaggccggcaagatctggtaccggacgctg
accgtgtacctgaacgccaactcgagctatccgaacgcgcggcgtgcgtcgatccaggcg
gcaaacgacctgtatggcgcgaactcggccgaaagcgcgacggtcgcgcgcgcgtggagt
gcggtgggggtgaattga

DBGET integrated database retrieval system