KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6602Help
Entry
Bcen2424_6602     CDS       T00415                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ser_hydrolase Abhydrolase_4 PGAP1 Abhydrolase_5 Ndr FSH1 DUF676 Thioesterase Esterase Abhydro_lipase
Motif
Other DBs
NCBI-ProteinID: ABK13332
Position
3:827806..828591
Genome map
AA seq 261 aa AA seqDB search
MTTTLIRDIAVEITGEGQPVVCIHGLGGSSNNWTPVLEAFGGMRVVRLDLPGSARSALAN
EPLSIELYVSRVADVLSELGIEQAHIVAHSMGTIVAQHLAVQHPHLVRSLALFGPLLAPP
DQGRPAIRARAALCRDRGIAGLQEIADAIVKGATSVETKSVRPVTVALVRESVMRQSPEG
YAQSCLALSEASEAAIDQISVPTLLVTGDEDAVGQPALVKNMSERIDGSTLTVLRGCGHW
TTFEKPAECIAELKAFYDNDK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaccctcatcagagatattgccgtcgagataaccggggaaggtcagcccgtc
gtgtgcatccacggactcggtggctcctcgaacaactggaccccggttctggaagccttt
gggggcatgcgtgtcgtccgactcgacttgcccggtagcgcgcgttcagcgctagccaac
gagccgttgtccatcgaactgtacgtgtcccgggtggccgatgtgctgagcgaactcggt
atcgagcaggcccacatcgttgcacactcgatgggtaccatcgtggctcagcatctcgca
gtccaacatcctcatctcgtccgcagcctcgcgctctttgggccgttgctggcgccacca
gaccaaggccggcccgcgatacgggcgcgcgcagcgctgtgccgcgatcgaggcattgcc
ggcctccaagagatcgcggatgcgatcgtcaaaggcgctaccagcgtcgagaccaagtcc
gtgcggccggtgacggtcgcgcttgttcgcgaaagcgtcatgcgtcagtccccggagggg
tatgcacaaagttgcttggccctgtccgaagcgagcgaggcagcaattgatcaaatctcg
gtcccgacgctgctcgtgacgggggacgaagatgcggttggtcagcccgcgctggtcaaa
aatatgagcgagcgaattgacgggagtacgttgacggttcttcgcggctgcggccattgg
accacgttcgagaagcccgccgagtgcatcgccgaactcaaggcgttctacgacaacgac
aagtaa

DBGET integrated database retrieval system