KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6604Help
Entry
Bcen2424_6604     CDS       T00415                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Channel_Tsx
Motif
Other DBs
NCBI-ProteinID: ABK13334
Position
3:830071..830853
Genome map
AA seq 260 aa AA seqDB search
MDKNFGSWMRVLITMLVGFLSTSAMAQNFAVNNFNFLYTNRSSPDPIYGYGTGNGNLQTY
QFEHFSGNQFGDIYFDAELYHGNNVGAPFSNANFQNLLVFNPRLSFGKTLGKDLSVGPIS
DVSLIARWERGSYPDTDHFESQNYGLSLNFKVPGFAWFESGMLYRNTNFDKHTWLWRSVL
LSNPIEVGGQKFHFNLLSLINGSNHNGTEVFERAELLWEIFGKPQYQLGARFEFMHYNNN
PVGGGTYNKYMPEIMFKYTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaattttggatcatggatgagggtgctcatcacgatgctggttggcttcctc
agtacgtccgcgatggcccagaatttcgccgtcaacaacttcaacttcctgtacacgaat
cgttctagcccggatcctatctatggctatggaacaggcaacgggaacctgcagacgtat
caatttgaacacttcagcggcaatcagtttggcgatatctatttcgacgccgagctttac
catggcaacaacgttggcgctccgttcagtaacgcgaacttccagaaccttctggtgttt
aacccgcgacttagcttcggaaaaacgctcgggaaagacttgtccgtcggtccgatttcc
gacgtatcgctcatcgcccgatgggagcggggaagctatcccgatacggaccatttcgag
tctcagaactacggcttgtcgctcaatttcaaggtcccgggtttcgcatggttcgagtca
ggtatgctttaccgaaacacgaacttcgataagcatacgtggctgtggcgatcggtgctg
ctctcgaaccctatcgaagtaggtggtcagaaattccacttcaaccttctgtcgctcatc
aatggttctaaccataacgggaccgaggtattcgagcgagcggagcttctgtgggagatc
ttcggcaagccgcagtaccaactcggtgctcgcttcgagttcatgcattacaacaacaat
cccgtcggcggtgggacctacaacaagtacatgccggaaataatgtttaagtatacgctt
tga

DBGET integrated database retrieval system