KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6606Help
Entry
Bcen2424_6606     CDS       T00415                                 

Definition
(GenBank) transposase Tn3 family protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_Tn3 DUF4158
Motif
Other DBs
NCBI-ProteinID: ABK13336
Position
3:833008..835989
Genome map
AA seq 993 aa AA seqDB search
MSTVHETIYPVLPAEPGAAELKAAFTPSTAEIRFVRRQSRQEATAVLIMVQLKLLQRLGY
FPMLADVQSVIIDHIRIAMRVRTLSRATIARYDVSGSRIRHQKLLRVWLDIRAFDAGETA
WLTELASAEARTKIELPDIINVLIEDLVRRRYELPPLATLQRIATQARNDLNAAIYEAIT
GALDATLIERIEALLVVKAGKSGWDDLKQEPKRPAARAIASFLKHINGIRKLAEGLPAPP
AIVSVSKRAQLVTEARALDVAELRSLKAAKRHALAVLFIQAQLQKAHDDVAEIFIKVVRK
LESYAKVRLQKYQLEHADVLEGLVGQFRDVLQILQDEGVSERNRLPKIREALGDPAEALA
QCNEHIAYAGQFDLPFMLVPYRTQRSLLFQCLDVLPLQSSSQDRAVLVALAWLQGFRNAH
REYLLLTDNDLANLPLDWLPEKWERAVFPHRRDSRMLHRRFFELGVFSQIMRELHSGDLY
VEGSDRFDDYRVHQVTDEEFRRELPRYCEIVGLPADGKSVAKDLRDRLNAALDEADANFP
ANDSIEFVNEELVIHKPGKEPEPPNRSLIDQAITASMPQVSILDLLTETEQWFDLHKLFG
PLSGFDAKVDDPRKRFITTLFCYGCNLGPSQTARSVKGLSRKQVAWLNLKHVTEERLDKA
IVKVINAYNQFALPKYWGSGKRASADGTKWSLYEQNLLSEYHVRYGGYGGIGYYHVSDMY
IALFSHFIPCGVHEAVYILDGLIQNGADIKPDTIHGDTQAQSGPVFGLSYVTGINLMPRM
RNIKDLVLYKADRRRKYAHIDSLCRRAIDWDLIERHYPDMMRVAVSIKAGKMTPSTILRR
LGSESTKNKLYFAFRELGRVIRTLFLLKYLNDPDLRRTIHAATNKSEQFNDFAQWLMFGG
EGIIAENVRHEQRKVIKYNHLVANMVILYNVQWMSRKLKELQQKGHPVDAEVLKVLSPYR
REHINRLGDYLLDLQRPVPPLDPTIDFAFKSAA
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtccacgagaccatctatccggtgctgcctgccgagccgggcgcggcggag
ctgaaagctgcgttcacgccgagcaccgcggaaatccgattcgtacgccggcaatcccgt
caagaagcgaccgccgtcttgatcatggtgcaactgaagttgctgcagcgtctcgggtac
tttccaatgctcgcggatgtgcagtccgtcattatcgatcacatccggatcgcgatgcgg
gtccgcaccttgtcccgggcaacgattgcgcggtacgacgtgtccggcagccgcatccgt
caccagaaactgctgcgcgtctggctcgacatccgagcgtttgatgcgggtgagacggcg
tggctgactgaactcgcgtcagcggaggcccggacaaagatcgaactgcccgacatcatc
aatgtgctgatcgaggacctggtccgccgccggtacgagctgccgccgctggcgacgctg
cagcgcatcgccacgcaggcgcgcaacgatctgaacgcggcgatctatgaagccatcacc
ggcgcactcgatgcaaccctcatcgaacggatcgaggcgctgctcgtcgtcaaggccggc
aagtctggttgggacgatctgaaacaggagccgaagcgacccgccgcgcgggcgatcgcc
agcttcctcaaacatatcaacgggatcaggaaactggcggaaggcttgccggcgccgccc
gcgatcgtctctgtcagcaagcgggcccaactggtcaccgaagcgcgggcgctcgacgtc
gcggaactgcgttcgctcaaggccgcgaagcgtcatgcgctcgcagtgctgttcatccag
gcgcagttgcagaaggcgcacgatgacgtcgccgagatcttcatcaaggtggtgcgcaag
ctcgagtcctacgccaaggtccggctgcagaaataccagcttgaacacgccgatgtgctg
gaggggctggtcgggcagttccgggatgtcctgcagattctccaggacgagggcgtatcg
gagcgcaaccggttgccgaaaatccgcgaggcgctcggcgacccggccgaagcgctcgcg
caatgcaacgagcacatcgcttatgccgggcagttcgatctgccgttcatgctcgtgccg
taccgcacccagcgctcgctgctgttccagtgcctggacgtgctgccgctgcaatcgagc
tcgcaggaccgcgcggtgctggtcgcgctcgcgtggctgcaaggtttccgcaacgcgcac
cgcgaatacctgctgctgaccgacaacgacctcgcgaacctgccgctggactggttgccg
gagaagtgggagcgcgcggtgttcccgcacagacgggacagccggatgctgcaccgccgg
ttcttcgagctgggtgtcttcagccagatcatgcgggaactccattccggcgacctctat
gtggagggcagtgaccgcttcgacgattatcgggtgcatcaggtcaccgacgaggaattt
cggcgtgaactgccgcgctactgcgagatcgtgggcttgcccgcggacggcaagagcgta
gcgaaggatctgcgagacaggctgaacgcggcgctcgacgaggccgatgcgaacttcccc
gcaaacgacagcatcgagttcgtcaatgaggaactcgtcattcacaagccgggcaaggag
cccgaaccgccgaaccggtcgctgatcgatcaggccatcacggcgtcgatgccgcaggtc
agcatcctggatctcctcaccgaaaccgagcagtggttcgacctgcataaactgttcggc
ccgctgtccgggttcgacgcgaaggtcgacgatccgcgcaagcgtttcatcacgacgctg
ttctgctacggctgcaacctcggtcccagtcaaaccgcacgctcggtgaagggactaagc
cgcaagcaggtcgcctggctgaatctgaagcacgtcaccgaggagcggctcgacaaggcg
atcgtgaaggtgatcaacgcgtacaaccagttcgcgttgccgaaatactggggcagcggc
aagcgcgcgtcggcggacggcaccaagtggagcctgtacgagcagaacctgctgtccgaa
taccacgttcgttatggcggatacggcgggatcggctactaccacgtgtccgacatgtac
atcgcgctgttcagccacttcatcccgtgcggcgttcatgaagccgtctacatcctcgac
ggcctgatccagaacggtgcagacatcaagccggatacgatccacggcgatacgcaggcg
cagagcggtcccgtgttcggcctgtcttacgtgacgggcatcaacctgatgccgcgcatg
cgcaacatcaaggatctggtcttgtacaaggccgaccggcgtcgcaagtacgcgcacatc
gacagcctgtgccgccgggcgattgactgggatctgatcgagcggcactatcccgacatg
atgcgcgtcgcggtgtcgatcaaggcgggcaagatgacgccgtcgacgatcctgcgccgg
ctaggctcggaaagcacgaagaacaagctctatttcgcgttccgggagctggggcgcgtg
atccgtacgctgttcttgctgaagtatctgaatgaccccgacctgcgtcgtacgattcac
gcggccaccaacaagagcgagcagttcaacgatttcgcgcagtggctgatgttcggcggc
gaaggcattatcgcggaaaacgtccggcacgagcagcgcaaggtcatcaagtacaaccac
ctcgtcgcgaacatggtgatcctgtacaacgtgcagtggatgtcgcgcaaactgaaagag
ctgcagcagaaggggcatccggtcgacgccgaggtgctcaaagtgctgtcaccgtatcgg
cgggaacatatcaatcgacttggggactatctgctggatctgcaacgccccgttccacca
ctcgatccgaccatcgatttcgctttcaaatcagcagcttaa

DBGET integrated database retrieval system