KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6610Help
Entry
Bcen2424_6610     CDS       T00415                                 

Definition
(GenBank) amino acid ABC transporter ATP-binding protein, PAAT family
  KO
K02028  polar amino acid transport system ATP-binding protein [EC:3.6.3.21]
Organism
bch  Burkholderia cenocepacia HI2424
Module
bch_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bch02000]
    Bcen2424_6610
Enzymes [BR:bch01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.21  polar-amino-acid-transporting ATPase
     Bcen2424_6610
Transporters [BR:bch02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Bcen2424_6610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_22 AAA_16 AAA_29 RsgA_GTPase ABC_ATPase AAA_33 AAA_5 Mg_chelatase T2SSE AAA_25 AAA AAA_30 SbcCD_C AAA_15 NB-ARC IstB_IS21 MMR_HSR1 AAA_18 AAA_23 NACHT ATPase_2
Motif
Other DBs
NCBI-ProteinID: ABK13339
Position
3:complement(838714..839451)
Genome map
AA seq 245 aa AA seqDB search
MPQLEIVDLKASYGAHTVLERINLSIEKGEVVSLIGPSGSGKSTLLRVLLGLLPLAQGSV
LLDGREIDYASRERVRALRTDVAIVFQQYNLFQNMTALENVMITPTKIRGRPSGQVEREA
TELLTRVGLAHRLHAYPDELSGGQQQRVAIARALALKPKLLLLDEVTAALDPELVNEVLD
TIHALARDGITMVIVSHEMSFVRQVSTKVVFMAGGQVVESGSPQAIFDAPQESRTREFVG
KILRH
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcaactcgaaatcgttgatctgaaagcatcgtatggcgctcataccgtcctcgaa
cgcatcaatctttccatcgagaaaggcgaggtcgtcagcctgattggtccgtccggatcg
ggcaagagcacgttgttgcgcgtgctgctcgggttactgccgctcgcgcagggcagcgtg
ctgctcgatgggcgcgaaatcgattacgccagccgcgagcgcgtgcgcgccttgcgcacg
gatgtcgcaatcgtgttccagcaatacaacctgtttcagaacatgactgcgctcgagaac
gtgatgatcacgccgacgaagattcgcggcagaccgagcgggcaggttgaacgggaagca
acggagctgctcactcgcgtcggtctcgctcaccggctgcatgcctatcccgacgagttg
tccggcggacagcagcagcgtgtcgcgattgcccgtgcgctggcgctgaaacccaagctg
ttgctgctggacgaggtgaccgcggcactcgatccggaactcgtcaacgaagtgctcgat
acgatccacgcgctggcgcgagacggcatcacgatggtgatcgtgtcgcacgaaatgagc
tttgtccggcaggtatcgacgaaagtggtgttcatggcgggcggacaggtggtcgagtcc
gggtcgccgcaggcaattttcgatgccccgcaagaatcacggacgcgcgaattcgtggga
aagattctgcgccattga

DBGET integrated database retrieval system