KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6792
Entry
Bcen2424_6792     CDS       T00415                                 
Name
(GenBank) hypothetical protein
  KO
K12067  conjugal transfer pilus assembly protein TraE
Organism
bch  Burkholderia cenocepacia HI2424
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_6792
Secretion system [BR:bch02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bcen2424_6792
SSDB
Motif
Pfam: TraE
Other DBs
NCBI-ProteinID: ABK13521
Position
p1:3155..3766
AA seq 203 aa
MTPGKAAQSREQLQSENRFLKKVLLGNGTTSVVIALTCAWLVITQRVIIMPPAVRGTYVI
GARYANDQYLADQAAYVLALSKSVTPTTVDNNVRILLSMVDDDRRAALKTEWEADALQIK
HDGVTNVFEPMGVGEVDFRNKAVKVTGTLTTYISGKRTSSEQKTYEVYFGITVFGRLVLL
DIREATRGKQGVEPLVTTETPAS
NT seq 612 nt   +upstreamnt  +downstreamnt
atgacacccggtaaagccgcccaatcacgcgaacagctgcagtccgagaaccgctttctg
aagaaagtgctgctcgggaacggcaccaccagtgtggtcatagccctcacctgcgcatgg
ctggtcatcacgcagcgcgtcatcatcatgccgccagccgttcgcggcacctacgtcatc
ggggcccggtatgcgaacgaccagtacctcgccgatcaggccgcgtacgtgctcgccctt
tccaaaagcgtcacgccgaccaccgtcgacaacaacgtacggattctcctgtccatggtc
gatgacgatcggcgcgccgcgctcaagaccgaatgggaggccgacgcgctgcagatcaag
cacgacggcgtgacgaacgtcttcgagccgatgggggtaggtgaggtggacttccgcaac
aaggccgtgaaggtcaccggcaccttgaccacctacatctccggcaaacgcacgagctcg
gaacaaaagacctacgaggtctatttcggaatcaccgtcttcggccgcttggtcctcctc
gacatccgagaagccacgcgcggcaaacaaggcgtcgagccgctggtcacaacggagact
cccgcatcatga

DBGET integrated database retrieval system