KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6793
Entry
Bcen2424_6793     CDS       T00415                                 
Name
(GenBank) conserved hypothetical protein
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
bch  Burkholderia cenocepacia HI2424
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_6793
Secretion system [BR:bch02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bcen2424_6793
SSDB
Motif
Pfam: TraK
Other DBs
NCBI-ProteinID: ABK13522
Position
p1:4030..4509
AA seq 159 aa
MPANPTALNESITVFVIDDAGTTYRLLLVPGPRPAEDVRIEPPAARSTQALQASAFQRRV
KLMMLAMAGGRGAPQLSYTSLDTVVPLWKEAVLTLVRQYSDGDFIGETYTLSNTSHTDMA
IDERELYAPGVLAIAIENANLPAGASTIVYVVRERGDHE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcccgcgaatcccaccgcgctgaatgagtcgatcacggtgttcgtgatcgatgacgct
ggcaccacctaccgtttgttgctcgtacctggtccgcgaccggccgaagatgtccgtatc
gaaccgcctgcagcgcgctcgacccaggcgctccaagcatcggcctttcaacgacgggtg
aagctcatgatgctggcgatggccggtggtcggggggcaccgcagctgtcgtacacgtcg
ctcgacactgtcgtgccgctctggaaggaggctgtattgacgctggtccgtcagtacagc
gacggcgatttcattggcgagacgtacacgctctcgaatacctcgcacactgacatggct
atcgacgagcgcgaactctacgcgccgggcgtgctcgccatcgcaatcgaaaacgcaaac
ctgccggccggcgccagcacgatcgtctatgtcgttcgtgagcggggcgaccatgagtga

DBGET integrated database retrieval system