KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6794
Entry
Bcen2424_6794     CDS       T00415                                 
Name
(GenBank) TraB pilus assembly family protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
bch  Burkholderia cenocepacia HI2424
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_6794
Secretion system [BR:bch02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bcen2424_6794
SSDB
Motif
Pfam: TrbI DUF4164 ABC_tran_CTD SKA2 DUF4407
Other DBs
NCBI-ProteinID: ABK13523
Position
p1:4502..5824
AA seq 440 aa
MSDVNQATKRRQRILTVAGFAVLAGLFAVGMFFTQSGPANRQFTTKVPFTSLGDQNDRNA
WRAHSEAQLAELTRRMSSIDSRADDAVSQMKALSKAQDELSKRIDAMKSTPASAPAPASG
ATSDRAALDKPIPLNGAPAKTGAILNPPFGKSGKPGVDMAAAPPKLAIIQFNTPTGNGAD
CVDPRYSSLPLDQATRAQQDCLKANGKKKISFIPGSSFVRVFMMNGVDAPTGGEAQHDPL
PVFLQVLDPANLPNSRKLDITECRILTQAYGDVSSERTHMRGETLDCILKNGRTVEMPIK
GNVMGEDGKEGVRGRLVSKAGSALAMSVFAGISSGIGQAFNQSANTLSNTALGSTSIINP
SQVGRAAIGSGVSGGADALKQYYIRTAEKLFPVIETDGGRIVEFAVTKGAEYDGALSDIS
NINDGLANDGRANDGGYSDD
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgagtgatgtcaatcaagcaaccaagcgccgccagcggatcctgaccgtggccggtttc
gccgtcctcgctggcctcttcgccgttggtatgttcttcacgcagagcgggccggccaat
cgtcagttcaccacgaaggtgccgtttacgagcctcggcgaccagaacgatcgcaatgcc
tggcgggctcactccgaggcgcaactcgctgagcttacgcgcaggatgtcgagtatagat
tcgcgcgccgacgatgccgtgtcgcagatgaaagccttgtcgaaagcccaggacgagctc
agtaagcggatcgacgcgatgaagagcacgccggcaagcgcgcccgcgcccgcgtccgga
gcaacctcagaccgcgcggccctggacaagccaattcccctcaacggggccccggccaag
acgggcgcaatcctgaatccgccattcggcaaatccggcaagcccggtgtcgatatggct
gctgcccctccaaagctcgccatcattcaattcaatacaccgaccggcaacggggccgac
tgcgtcgacccccgctactcgtcgttgccgttggatcaggcgacacgtgcacagcaggac
tgcctgaaggccaacggcaagaagaaaatcagcttcatcccgggctcctcatttgttcgc
gtattcatgatgaacggtgtcgacgccccaacgggcggtgaggcgcagcacgacccgctt
cccgtgttcctccaggtattggacccagccaatctgccgaacagccggaagctcgacatc
acggagtgccggattctgacgcaggcgtatggcgatgtgtccagcgagcgcactcacatg
cgcggcgaaacgctcgactgcatcttgaagaacggccgaaccgtggaaatgccgatcaag
ggcaacgtgatgggcgaggacggcaaggagggtgtgcgaggtcggctcgtctcgaaggcg
ggatcggcattggccatgtcggtgttcgccggtatctcgtccgggattgggcaagcgttc
aatcagtccgccaacaccctcagtaataccgcccttgggtccacctccattatcaatccg
agccaggtcggccgtgctgctatcggcagtggcgtctctggaggcgccgacgctcttaag
cagtactacatccgcacggctgagaagcttttccccgtgatcgaaacggacggtggccgc
attgtcgagttcgccgtgacaaagggagccgaatacgacggcgccctctccgatatcagc
aacatcaacgatggcttggccaacgatggccgtgctaacgatgggggctactccgatgat
tga

DBGET integrated database retrieval system