KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6801
Entry
Bcen2424_6801     CDS       T00415                                 
Name
(GenBank) conserved hypothetical protein
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
bch  Burkholderia cenocepacia HI2424
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_6801
Secretion system [BR:bch02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bcen2424_6801
SSDB
Motif
Pfam: TraC_F_IV DUF5934 P-loop_TraG AAA_10 ABC_tran FtsK_SpoIIIE PIF1
Other DBs
NCBI-ProteinID: ABK13530
Position
p1:9752..12346
AA seq 864 aa
MSTLQAWIDDAKSLARTAISEAILGTEDDLGPPAPVAADQRRVETVGLHNLLPYDQYDPA
TELYYNTDSVGFVLAVAPQTGADAELTRSLHGLYDSVPAGYGLQWMLLGDPIIEESLNAY
VDLRREYAEAGRAPSFYLEQAERRAAFIRGKLGQPLFLGQNYSITDKRLLLSIVRKGSLD
DLKLIEEIQNIRDVVGATLSSASLASRTAEPDDLKRFLWPILNPSAFFGDGAETIDQTYS
DDKPIRDQLTAFGHHMRVKAKHLLYGVPPEDADEPDARIAVRSFGVHQYPKSKELWEMNN
IVGSLFNDVHQYPCPYLITLGVLILDQTAVETRAALRGARATQNAESKIAKLQPELALQN
QDWKAVSMQLTQGGSMCELYHTLTLFAPRKKMEQCVAAAKGIWRSERFKLFPMLTQQLTT
FLSALPMMLTSDMRDDLKKFRLITTKTTVNATDMAPVLGEWSGTSGRANLLFFGRRGTPA
LVDIYSSGTNYNGFVDGTSGAGKSVLLNEIIGAFRSVGGIVRICDVGYSYEKQIDMGDGQ
YIDFKPGSRIIINAFSTAGIDTENGLDSEVKFIRPIIARMVSPTAPITPFEGALLDVAVR
IVWKDYGQEGSPTLVRDALLSLKDQNGQPERIAYELAVRLEPFCKGGVYGDYVNGRTNVS
LDNEVVGLELEHLNSDPQLRTVIMLGLTNQVTNEMYRFDRSRPKLFLQDEGWQIVGDDQE
SADFMEEGYRRARKYEGSFFFATQGITDAGMNKATQAAFDNSAWKFHLKQSDDTLKKIEK
GDVMDLSPGLKRMLKSLRPVPGRYSEFVLVDPNGGTHLLRHIPDEFTLAMATTKGPDYEF
MERLRTSGTSTEDAIRALIQAKRK
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgagcaccctgcaggcctggatcgacgacgcgaaatcgctcgcgcgaacagcgatcagc
gaagcaatcctcggcaccgaggacgacctcgggccacccgcccccgtcgctgccgaccag
cggcgcgtcgagacagtcggacttcataacctgctgccgtatgaccagtacgaccccgcc
acggagctctactacaacacggattccgttggcttcgtgcttgcagttgcaccgcagacg
ggcgctgacgcggagttgacccgcagtctccacggcctatatgactcggttcctgccggc
tatgggcttcaatggatgctgctgggcgaccccatcatcgaggagtcgttaaacgcctac
gtcgacttgcggcgcgagtacgccgaggcgggccgtgcaccctcgttctatctggagcag
gccgagcgccgcgccgcgttcatccgcggcaaactcggccagccgctgtttctgggccaa
aactactcgatcacggacaagcggctgttgctgtcgatcgtgcgcaagggctcgctcgac
gatctgaagctgatcgaagaaatccagaatattcgcgacgtcgtcggcgcgacgctgagt
tccgcaagcctggcaagccgtactgcggagcccgacgatctgaagcgctttctctggccg
atcctcaaccccagtgcgttctttggcgatggagctgagacgatcgatcagacctacagc
gacgacaagcccattcgtgaccaactgacggctttcggtcaccacatgcgtgtgaaggcg
aagcatttgctctatggagtgccgcccgaggatgcggacgagcccgacgcacgcatcgcg
gtgcgcagctttggcgtgcaccagtatccgaagagcaaagagctctgggagatgaacaac
atcgtaggttcactcttcaacgatgtccatcaatacccctgcccgtacctgatcacgctc
ggcgtcctgattctcgatcagaccgccgtcgagacacgggccgctctgcgtggtgctcgc
gcgacacagaacgccgagtcgaaaatcgcgaagctgcagccggaactcgccctgcagaac
caggactggaaagccgtctcgatgcagctcacgcaaggtggctcgatgtgtgagctctat
cacacgctgacgctcttcgctccgcgcaaaaagatggagcagtgtgtggcggccgcgaaa
ggaatctggcgctcggagcgcttcaagctgttcccgatgctgacccagcagcttacgacg
ttcctgtcggccctgcccatgatgctgacaagcgacatgcgggacgacctcaagaagttc
cggttgatcactaccaagaccaccgtgaatgcgaccgacatggcgccggtgctgggcgaa
tggtcgggtaccagtggacgagccaatctgctgttctttgggcgccgcggtacgcccgcg
ctcgtagacatctactcgagcggaacgaactacaacggctttgtggatggtacttccggc
gccggtaaatcggtacttctgaacgagattatcggagcgtttcgctcggtcggcggaatc
gtccggatctgcgatgtgggctactcgtatgaaaagcagatcgacatgggcgacggccag
tacatcgacttcaagcccgggtcgcgaatcatcatcaatgcgttttcgacggccggtatc
gataccgaaaatggcctcgacagcgaggtgaaattcatccggccgattatcgcgcgcatg
gtatcgccgaccgcacccatcaccccgttcgagggtgcgttgctcgatgtcgcagtgcgc
atcgtatggaaggactacggtcaggaaggtagtcccacgttggtgcgggacgccttgttg
agcctgaaggaccagaacgggcaacccgaacgcatcgcgtatgagcttgccgtgcgtctc
gaaccgttctgcaagggcggtgtttacggcgactacgtcaacgggcgcaccaacgtaagc
ctcgataacgaagtggtgggccttgaactcgagcacctcaacagcgatccccaactgcgc
acggtgatcatgctcggcctgaccaatcaggtcaccaacgaaatgtaccgctttgaccgg
tcgcggccgaagctattcctgcaggacgagggctggcagatcgtcggtgacgatcaagag
tcggccgacttcatggaagaaggctatcggcgtgcgcgcaaatatgaaggcagcttcttt
ttcgcgacgcaggggatcaccgatgcggggatgaacaaggctacgcaggccgccttcgac
aactccgcatggaagttccacctcaagcaaagcgacgacacgctcaagaagatcgagaag
ggcgatgtgatggatctgtcaccggggctgaagcgcatgttgaagtcgctgcgcccggta
cccggtcgctatagcgagttcgtccttgtcgatccgaacggaggcactcacctgctgcgc
catatccccgacgaattcactctggccatggcaaccaccaaggggccggactacgaattc
atggagcggttgcgtaccagcggcacttcgaccgaagacgccatccgcgccctgatccaa
gccaaacggaaatga

DBGET integrated database retrieval system