KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6814
Entry
Bcen2424_6814     CDS       T00415                                 
Name
(GenBank) TraH family protein
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
bch  Burkholderia cenocepacia HI2424
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_6814
Secretion system [BR:bch02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bcen2424_6814
SSDB
Motif
Pfam: TraH zf-TFIIB
Other DBs
NCBI-ProteinID: ABK13543
Position
p1:22202..23647
AA seq 481 aa
MKPTRWIVAMTAAVFAIAPVCTQAMSMQQVFDSINAMGNVSSPRALQGETMDMYSGGSVF
MRTPHKTYQLASVTAPEWGAGCGGIDLFTGGFSFINKEQFVALLRNIGSNALGYAFKLAL
QNLCPTCDNVMQSLQAIARDVNRMNIDSCQAAEGIVNAVTPVAWKKEQANLADTLGPFTN
LYSDMTDAWTNTGNSSAQAAQTINTATASDSNLAAKQPYGNVTWQALQQLPDLSTSDREF
LMSLVGTVIFPAPSDSGGTEVNPVFLPRIGSLTVQELVGNDPAANSGTTIQVYVCDETTK
CLNPSVQEIGYTPFRTLVQQKLQVITDAIASRSAIPNPADTFRFLSMTDLPVYKMIAVGT
RLNNSSLADQLLSTYQSLIAAKYAEAYIHGSAEDLRRAIARYGTVKSSTSLLDEATKLNT
NIDTVESEARSVVMQAFSQTSNAWQLVEQLQSIERAVHANVSSSLRNSLAFGQTLNGGST
Q
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaaaccgacacgctggattgtcgcaatgacggctgcagtgtttgccatcgccccggtc
tgtacgcaggcgatgtcgatgcagcaggtcttcgactctatcaacgccatgggcaacgta
tcgagcccgcgggcgttgcagggcgagacgatggatatgtacagcggcggaagcgtgttc
atgcgcacgccacacaagacttaccagctcgcgagcgtcacggccccggaatggggagcg
ggttgcggcgggatcgacttgttcaccggcgggttcagcttcatcaacaaagaacaattt
gtcgcgctgctgcgcaacatcggctcgaacgcgttgggctacgcattcaagctcgcctta
cagaacctctgcccgacctgcgacaacgtcatgcagtccctgcaggccatcgcgcgcgac
gtcaaccggatgaacatcgactcgtgccaggccgcggagggcatcgtcaatgcggtgacg
cctgttgcgtggaaaaaagagcaggcaaacctcgccgacacgctcgggccattcacgaac
ctgtattcggatatgaccgatgcctggacaaataccggaaacagctcggcgcaggcggcg
cagacgatcaacacggcgactgcgtcggattccaatctcgcggccaagcagccgtacggg
aatgtgacgtggcaggcactgcagcagctgccggacctgagcacgtcggatcgcgaattc
ctgatgtcgctggtggggacggtcatcttccccgccccgtcggattctggcggcacggag
gtgaatcctgtattcctgccccgaatcggtagcctcacggtgcaggagctcgtcggtaac
gatcccgctgcgaacagcggcaccacgattcaggtgtacgtgtgcgacgagacgacgaag
tgcctgaatccgtcagtgcaggaaattggatacacccccttccgtacgctcgtacagcaa
aagctgcaggtaatcacggatgcgatcgcatcgcgctccgcgatcccgaacccggcagac
acgtttcggttcctgagcatgaccgacctgccggtctacaaaatgatcgcggtcggcacg
cgcctgaacaattcgtctctggccgaccaactgttgagcacctaccagtcgctgatcgcg
gccaagtacgccgaggcctacatccacggatctgctgaagacctccgccgggcaatcgcg
cgttacggcaccgtgaaatccagcacgtcgctgctcgacgaggccacgaagctcaatacc
aacatcgacacggtggaatcggaagcacgcagcgtcgtgatgcaagccttcagccagacg
tcgaacgcgtggcagctggtcgagcaactccagtcgatcgagcgtgccgtgcacgcgaat
gtgtcgtcttcgcttcggaactcgttggcgttcggccagacgttgaacggcgggagcacg
caatga

DBGET integrated database retrieval system