KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6815
Entry
Bcen2424_6815     CDS       T00415                                 
Name
(GenBank) TraG domain protein
  KO
K12056  conjugal transfer mating pair stabilization protein TraG
Organism
bch  Burkholderia cenocepacia HI2424
Brite
KEGG Orthology (KO) [BR:bch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bch02044]
    Bcen2424_6815
Secretion system [BR:bch02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bcen2424_6815
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: ABK13544
Position
p1:23644..27585
AA seq 1313 aa
MNMEIDTYGNVDTLYFVMQGIASFMGSGTWTGLIRYTLLCGVVIWTIVAIGRKGYEIFRW
FAAAMLMTQLLLLPIENVFITDVNNVQPTREVDHVPAYLAAVAQSFTLISHVLTQSYETI
FSVPDTLTLKKGDVGFGISVLQKVNKAEITDPGLHADLIQFFKECTVYDIQDGAIDPKTI
MNGTDPFNTVFTSTSPARYVTTNTLTANPTTDTCSATGTLLLLRVQDAEQAAEQMYGSEM
YPEIADPSMAKAEFVNAIGDSYGFILQSSQNASSALRQAMFNNVWRQAGAELPAMLNDPA
RVAEVNALMSSAQAAVATNGSLASMAILAKNTLPTVRNYAEAIIYAVFPLILVLCLISGA
DGAKRILAMYAKTVAWVSIWPMLFAVINGLSLIHLSHEMRSMSLQAGVPFGMAAKFGQTL
LDEQALLGYMVIITPPLAWMLLNFASAGVVGAFSQLSGALTGSAQQIGGQQAQGDENIGN
VHMDSSSIDNASRNVTSANKYDNTVQSRTGSMNVDTGTGSAFTNFANGLIARTEFQNSLG
VSATSQDAFERSLGTDTSTGVAANRTNSTFAGREQLASSTNSVSSSQERGSSQRLSDDSS
SGTRASSSQTGERRTAHDQQYAIDQSHSVDGTTSAGAKGSIMLGGGFAKSFGEDGAPSGN
AGGGGGGSAGGSGRGPSGNGRQGSSNPVSNSPLFNQAEEDKLARKAESLGKSPNEVQAIR
DAYRSKVRAADYANGGGTGKGQSSLKFGLDVSGEGGYTKSWRNSDAQKFVDQNSSLAAYT
ESDNVSHEGSQMHNDSTGMESGQHVRSDRSASLTDQVSSGSRVAADLTRSADVRQRGSTQ
VVSRVDTSTNLMTPENLQAVAARNGMRYSQLMTLPSPQIAQLVAQDAAMRDIVSRNSTLP
TTARDGSTLPASGIDVVRQDQRNQSGVGASAPASFRRFAGAVGPVDTTPLDVATPMPQIV
TAAQHRVDVTQQRVASESAAPIKQVRDHVDPSADNKPLMTPERAPGRSLSSPPVAPSASD
SKGPLSAWVNSIQPSGPAGTTSTSAPIENFLRPRTTGNGPTLEAARAAETGTGWPATQPR
LSESDFRIVTLPAGNDHMSHRQSDHRVPDAPDVTYSRPSPELSSPDQEAVAPPVGSIRGR
RVVDDGSRGSSLPTASMKRSGGVSVMAPGTTAGNSGSRVDNVKPANAGQEQATPAPIAPE
TVGRRSSTSGGIGLASVGSEVGGVDRKVQIDRTPGGSSAAGDALPPTPSLYLDAATVGAD
ASAPHDDSAVSGAATSPSVLVSASRLGRGSADDARGVKSLPSAGVASDDPDNQ
NT seq 3942 nt   +upstreamnt  +downstreamnt
atgaacatggaaatcgacacctatgggaacgtcgatactttgtacttcgtcatgcagggt
atcgcgtctttcatgggtagcggcacctggacaggtctcatccgctacacgctgttgtgc
ggggtggtgatctggacgattgtcgcgatcggtcggaaaggctacgagatcttccgctgg
ttcgccgccgcgatgctgatgacgcagctgctgttgctgcctattgagaacgtgttcatc
accgacgtcaacaacgtgcagccgactcgggaggtggatcacgtccccgcgtatctcgcc
gccgttgcccagagcttcacgctcatctctcacgtgctgacgcagtcgtacgaaacgatc
ttttcggtgccggatacgctgaccctgaaaaagggcgatgtgggtttcggcatctccgtg
ctgcagaaggtgaacaaggctgaaatcactgatccggggctgcacgccgaccttattcag
ttcttcaaggagtgcacggtctacgatatccaggacggcgcaattgatccgaagacgatc
atgaacggcacggaccccttcaataccgtgttcacgtcgacgagccctgcacgatacgtg
acgacgaacacccttaccgcgaaccctacgacggacacgtgttccgcgaccggcactttg
ttgctgctgcgcgtacaggacgctgagcaagcggccgagcagatgtatggcagcgagatg
tatccggagatcgccgacccctccatggcgaaggcggagttcgtcaacgcgatcggagat
tcgtacggcttcatcctccagtcgtcgcagaacgcgtcctcggcgctacgacaggcaatg
ttcaacaacgtatggcgtcaggcgggcgcggagctgcccgcgatgctgaacgatccggcg
cgcgtggcagaggtcaatgcgttgatgagttcggcccaggctgcggtggcgacgaacggt
tcgcttgcctccatggcgattctggccaagaacacgctgccgactgttcgcaactatgcc
gaagcgattatctatgcggttttcccgctcattctggtgctctgcttgattagcggcgcg
gatggggccaagcgaatcctcgcgatgtacgcgaagacggtggcgtgggtatctatctgg
ccgatgctcttcgcggtcatcaacgggctgtcgctgatccacctgagccatgagatgcgc
tcgatgtcgctgcaggccggcgtgccgttcgggatggcggcgaagttcgggcagacgttg
ctcgacgagcaggcgctgcttggatacatggtgattattacgccaccccttgcgtggatg
ttgctgaatttcgcgtcggccggcgttgtcggtgcgttttctcaactgagcggcgcgctg
accggctctgctcaacagatcggcggccagcaggctcagggcgacgaaaacatcggcaac
gtgcacatggattcgtcgtcgatcgataacgcgtcgcgcaacgtgacctcggcgaacaag
tacgacaacactgtgcagtcgcgcaccgggtcgatgaacgtcgataccgggaccggctcg
gccttcacgaactttgcaaatggcctgatcgctcgcaccgagtttcagaacagcctcggc
gtttcggcaacctcccaggatgcgttcgagcggtcgctcggcaccgacacctcgacgggt
gtcgcggcaaaccgaacgaattccacgttcgctgggcgggagcagcttgcgtccagcacg
aacagcgtctcgagcagccaggagcgtggaagctcacagcgcctgtccgacgattccagc
tcgggtacgcgggcctcgtctagccaaacaggtgagcggcggaccgcacatgatcagcaa
tatgcgatagatcagtcacactccgtcgacggtacaacttctgcaggagccaaaggttcg
atcatgcttggtggcggctttgccaagtcgtttggcgaggatggggcgccatccggcaac
gccggcggtggaggcggcggctcagccggtggtagcgggcgtgggccttccggcaatggt
cggcaaggaagtagcaatccggtctcgaactcgcctctttttaaccaagcagaagaagac
aaactcgctcgcaaggccgagtcacttggaaaatcgccgaacgaagttcaagcgattcgg
gatgcgtatcgatcgaaggtgcgggctgcggattatgcaaatggcggcggcacggggaaa
gggcagtcgagtctgaagtttggtctcgatgtttcgggcgaaggcggatatacgaagtct
tggcggaattctgacgcacaaaaattcgtcgatcaaaacagtagtttggccgcctacacc
gagagcgataacgtctctcacgaaggctcgcagatgcacaacgactccaccggaatggag
tccgggcagcacgttcgcagcgaccggtcggcgtctctgacggaccaggtttcgtccggc
tcccgcgttgcagcggatctcactcgcagcgcagacgtgcgccagcgcggatcgacgcaa
gtggtttcgcgcgtagatacctcgaccaacctgatgacgcctgagaacctgcaggcggtc
gctgcgcgcaacggtatgcgatacagccagctgatgacgttgccgtccccgcagatcgct
cagctggtcgcccaagatgcagcgatgcgcgacatcgtttcgcgcaactcgacgttgccg
accacggctcgtgatgggtctactctccctgcgagcggcatcgacgtcgttcgccaggac
caacgcaaccagtccggcgttggtgcaagtgcccccgcgtcgttccggcgatttgcaggt
gcggttggaccagtggatacgacacccctggatgttgcgacgccgatgccccaaatcgtg
accgccgcacagcaccgtgtggatgttacgcagcaacgggtcgcaagcgagtccgccgcg
ccgatcaagcaggtgcgtgaccacgtcgatccgtcggccgacaacaagccgctcatgacg
cccgagcgggcgccgggccgctcgctttcctctccgcccgtggcgccgtcagcttccgat
agcaaggggcccctgtcggcatgggtgaactcgattcagccgagcgggccggctggaaca
acgtccacctcggcaccaattgaaaacttcctacgtccgcgaactacgggaaatggcccg
actcttgaagccgctcgagcggcggaaaccggcacgggctggcccgcgactcaaccgcgc
ctgtccgaatctgacttcaggatcgtgactctgccggccggcaatgaccacatgtcacat
cggcagagtgatcatcgagtgcccgatgctcctgacgtgacatacagccggccgtctccg
gagctatccagccctgatcaagaagctgtagcgccgcccgtcggctcgatacggggtcgc
cgggtggttgacgatggaagtcggggaagtagcttgccgaccgcatcaatgaagcgtagc
ggcggggtctcagtcatggctcctggaacgacggctggcaactctggttcacgagtcgac
aacgtcaaaccagcaaacgctggtcaggagcaggctacgccggcgcctattgcgcctgaa
acagttggccggagaagttcgacgtccggtggcatcggcctcgcaagcgtcgggtcagaa
gtcggtggcgtcgacagaaaggtgcagatcgatcgcacgccaggcgggtcatctgctgca
ggggatgccttgccaccgacaccctcgctttacctcgatgccgcaaccgtcggcgccgac
gcatctgctccgcacgacgactcggcggtaagcggcgcggccacttccccgagcgttctg
gtttcggcgagtcgactaggacgcggttctgcagatgacgcacgtggagtcaagtcgctc
ccgagcgcgggcgttgcaagcgatgatcccgacaaccaatga

DBGET integrated database retrieval system