KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6944
Entry
Bcen2424_6944     CDS       T00415                                 
Name
(GenBank) Type IV secretory pathway VirD4 components-like protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf AAA_10 TMEM141
Other DBs
NCBI-ProteinID: ABK13670
Position
p1:157460..159568
AA seq 702 aa
MADQRSPSGLATFSRGTALWWQQAKLLTSAIVAVVIAAILVGALAGGAYLYFVTSAETRY
LTIKHVEAEILTVVPMANPNVSFHLGNDDTALPPAAALSFTEDAADEFFIYARNAALYAV
LTAIAVTFLSVLFWMEYGRGKLTDKQVRGAKLVKAKELIKELEARDDASPYRIAGVPMRK
KAEVLGTLFSGAQGSGKSQQFFALMDQVRARKKRAIVYDPSGEFTAAYYREGKDVILNPL
DARSPNWNAWREIQSEIHYDGLAEGLIPIPPNVADPFFAIAGRMVFKGAIRALGGDNKRT
NAALYKAIAHSNLEELHAILANESAATYVDPVTERTGMSLKMTVQNQLDCFRYLHDEGEP
FSIREWIQNEDEDDDSWLFITVNEEQKTALLPLISLWCDIAIRSLLTLKPIHRERLWYFY
DELPTLQKLEIMKLAVTNIRKYGGCFVLGIQDFSQLFQIYGEHLARTIISGCQTKLLLRV
TDGDAAKALANAIGQADLDEKEESLNLGIDERRDGMSVFARRNLRDLVLSSEILHLPDMQ
GYLVTPSDYPVARVKYEYVPHPQTVTPFIPRQTYDLWLPAGAAADRPAAPERQSTALPSP
PSPTARFGSDPSPSHSPSPNPSGAPTTAAEDSATNAASAGPAVGAPAPNTSGCVARPSNV
ISLSTGEIVDGDTGEVHSTSAPREPVTGERPTGRAGLGDLLG
NT seq 2109 nt   +upstreamnt  +downstreamnt
atggctgatcaacgctcccccagcggactcgccaccttttcacgaggaactgccctctgg
tggcaacaggcaaagcttctcaccagtgcgatcgtggcggttgtcatcgcggcaattctc
gtcggtgcgctggccggcggtgcatacctgtatttcgtcacgtccgccgaaactcgctat
ttgacgatcaagcacgtggaggcggaaatcctcacagtcgttccgatggccaatccgaac
gtctcgttccacctcggcaacgacgacacggcactgccgcccgctgcggcgctgtcgttt
accgaggatgcggccgacgagttcttcatctatgcgcgcaatgctgccctgtacgctgtt
ttaaccgctattgccgtcacgttcctttccgtcctgttttggatggagtacggccgcgga
aaacttaccgacaagcaggtgcgcggtgccaagctcgtcaaagcaaaggagctcatcaag
gaactggaggctcgagacgacgccagcccctatcgcatcgccggcgtgccgatgcggaag
aaggccgaagtgctcggcacactcttttctggtgcccaaggcagtggcaagtcccagcag
ttttttgcgctgatggatcaggtgcgcgcccgcaaaaaacgggcgatcgtctatgaccca
tcaggcgaattcaccgctgcgtattaccgcgaagggaaggacgtcatcctgaatccgctc
gacgcgcgtagcccgaactggaatgcctggcgcgaaatccaaagcgagatccattacgac
gggctggctgaggggctcatcccgattccaccgaatgtcgccgacccattcttcgcgatt
gcggggcgcatggttttcaagggagcgattcgtgcgcttggcggcgacaacaaacgaacc
aacgcagcgctgtacaaggccatcgcccatagcaatctcgaggaattgcacgcgatccta
gcgaacgagtctgcggcgacctacgtcgatccagtcactgagcgtacgggcatgagcctc
aagatgaccgtgcagaaccagctcgattgctttcgttacctgcacgacgaaggcgagcca
ttttcgatccgagaatggatccagaatgaggatgaagacgacgattcctggctgttcatt
accgtcaacgaggagcagaaaaccgccctgcttccgctcatcagcctctggtgtgatatc
gctatccggtcgctgctgacgctcaagccgattcatcgcgaacgtctctggtacttctac
gacgagctccccactctgcaaaagctcgagatcatgaagctcgccgttaccaacattcgg
aagtacggcggttgcttcgtactcggcatccaggacttttcccaactcttccagatctac
ggcgagcacttggcgcgcacgatcatctccggatgccagaccaagctcctgttgcgcgtg
accgatggtgacgcggccaaggcattggccaacgcgatcggtcaggccgacctcgacgaa
aaggaggaaagcctgaatctcggcatcgacgagcggcgcgacggcatgagcgtttttgcg
cgacgcaatctccgcgatctcgtcctctcatcagaaattctgcacctgcccgacatgcag
ggctatctggtcacgccgagcgactatccggttgcccgggtcaagtacgagtacgtcccc
catccccaaacggtgacgcccttcatcccgcgccaaacgtacgatctctggcttccggca
ggcgctgcagctgaccgtccggctgcgccggagagacaatcgactgcgctaccttccccg
cccagcccgacggcgaggttcggcagcgacccgtccccgtcccactccccgtcacccaat
ccttccggcgcaccgaccacggccgccgaggattcggcgaccaacgccgcttcggccggt
ccggctgtcggtgcccccgcgccgaacacttctggctgcgtagcacgaccgtccaatgtg
atctcgctgtcgactggcgaaatcgtcgacggtgacaccggcgaagttcacagtacgtcg
gctccccgcgagccagtcaccggcgaacggcccaccggccgcgccggtctcggcgacttg
ttggggtga

DBGET integrated database retrieval system