KEGG   Burkholderia cenocepacia HI2424: Bcen2424_6945
Entry
Bcen2424_6945     CDS       T00415                                 
Name
(GenBank) TrwC protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB
Motif
Pfam: TrwC AAA_30 AAA_19 AAA_22 AAA_16 AAA_11 Viral_helicase1 AAA_33 NTPase_1 Y2_Tnp PIF1 ATPase_2 NACHT
Other DBs
NCBI-ProteinID: ABK13671
Position
p1:159575..162469
AA seq 964 aa
MMSMHNVGSAGQALHYFSKDNYYTTDQGLEHSAWFGKGAATLGLNGQVDRNVFFKLLSGQ
VGDQQLGRVVLDENGEPEVVHRPGIDLTFSAPKSVSIAAEVFEDREVRLAHEEAVKEALE
YVEAYVARARKTVDGQTLVEPTGNVVAALFRHNTSRDLDPDTHTHALVMNATQRADGEWR
SLTNDELYVQQKVIGAIYTSSLARGLQKRGYAITAPDENGNFELVGVTREQIEHFSQRSA
ARDRWLRANGIDPANATAAEKERAVLATRERKVGVDHEALSVQWRERAQAVGLDYSVIQQ
KAREAREAGTDARVVKLSGIEALRFAASHLGEREIVLNQYDLVQTALEHAVGRTSPNQIL
DAYKKLVHQGKIVDLPDGNITTEKMLNTERWTVENALAQRDVTPAIAPAELVRSRIEQAI
ATARAERNDPTFDYTPGQRGAIEHALTGRDRIVAVQGLAGVGKTTMVKGTVQVAHEQGWL
VRGMAATGQAAKQLENDSGIQADTVTMFEIHEQRRQDDLKVLREYVPDLSRERELWLVDE
SSFLAQRQMARLFKMAERADAKVILLGDRLQLQAIEAGKPFEILQDEGVATAQMTQIQRQ
KNPELQQAVAITVGTADLAPDEPLTDLNLARNARAFDFLEQAGRVTEHEDPRDLIDLMAR
QYVDRGPRRNQTIIITPFNEDRVEINNAVRAELQERGELDVNDSAHTIFRSDGDMTRAKQ
KEAQYYTKDMTVRFGRDYQKILASRGEYMRVVGTRPDEGIVVLRKSDGSLMEWEPKKYNR
VEVYLSETRNLAARDVIRFTRGDELVKNGHEATVVSVNENQAVLRLADGKEIPWDLDAQR
HWDHAYAVTVHAGQGATREQAMLHIPSHKMERDPEDARRQSDVAMTVRRIFGDRSFYVGL
TRAVEDLQIFTTDAILARAAVSRHQDKSSAIETLREHELGEQANTQPQRQRRQQAAQQMQ
IEPD
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgatgagcatgcataatgtcggcagcgccggccaggcgctccactatttttcgaaagat
aactactacaccaccgatcagggactcgagcattcagcctggttcggcaagggggcggcc
accctaggtctgaacgggcaagtcgatcgcaacgtgtttttcaagttgctgtctgggcag
gtcggcgatcagcaactcggtcgcgtcgtcctggacgagaatggcgagcccgaggttgtg
catcgacccggcatcgacttgaccttttcggcgccgaagagcgtcagtattgccgcagaa
gttttcgaagatcgcgaggtccgcctcgcgcatgaagaggctgtcaaggaggcgctcgag
tacgtcgaggcgtatgtggcccgggcgcgcaaaacggtcgatggccagacgctagtggag
ccgaccggcaatgtagtagccgccctctttcgacacaacacgagccgagatctcgacccc
gatacgcatactcacgccctcgtcatgaacgcgacccaacgcgcggatggcgaatggcga
tcactcaccaatgacgaattgtacgtgcagcagaaggtgatcggcgcaatctacacgtcc
tcgctcgcgcgcgggttgcagaagcggggctatgccatcacggcacccgacgagaacggg
aatttcgaattggtcggcgtcactcgagagcaaatcgaacacttcagccagcgctcggca
gcgcgcgatcgatggctgcgggccaacggaatcgatcctgcaaacgccacggccgccgag
aaggagcgtgccgtgctcgcgactcgcgaacgcaaggtcggcgtcgaccatgaggccttg
tcggttcaatggcgtgagcgcgcacaagcagtcggcctcgactacagcgtcattcagcag
aaggctcgggaggcgcgggaagcgggaacggatgcacgggtcgtcaagttgtccggtatt
gaagccctacggttcgctgcgtctcacctcggtgagcgcgaaatcgtgctgaaccaatat
gacctcgtccagaccgcgctcgagcatgcggtcggccgaacgtctccaaatcagattctc
gatgcctacaaaaagctggtccatcaaggcaagatcgtcgaccttccggacggcaacatt
accaccgagaagatgctcaacacggagcgctggacagtcgagaacgcgctcgcgcagcga
gatgtgacgccggcgatcgcgcctgccgaattagtccggtccagaatcgaacaggccatc
gccaccgcgcgtgcggagcggaacgatcccaccttcgactacacccccggtcagcgaggc
gcgatcgagcatgcgctgacgggcagagaccggatcgtcgcggtgcaggggctcgccggc
gtaggcaaaaccacgatggtcaagggaacagtccaggtcgcgcacgagcagggttggctt
gtacgagggatggccgcaaccggccaggctgccaagcagctcgaaaacgactccggtatc
caggccgatacggttacgatgttcgagattcatgagcagcggcgccaggatgatttgaag
gtcctgcgcgagtatgtgccggacctatcacgagagcgcgagctctggctcgtcgacgag
tcatcattcctcgcccaacggcaaatggctcgcctatttaagatggcggaacgagcggat
gcgaaggtcatcctccttggcgaccgcctccagctgcaggccatcgaggcgggcaaaccg
tttgagatcctgcaggacgagggcgtggccaccgctcagatgacccagatccagcgccag
aagaatcccgagctgcagcaggcagtcgcgatcaccgtgggcaccgccgaccttgcaccg
gatgagcccctcaccgacctgaacctcgcacgtaacgctcgcgccttcgactttctcgag
caagctgggcgcgtgacggaacacgaggatccgcgagacctgatcgacctgatggcgcgc
cagtacgtcgaccggggaccacgaagaaatcagacgatcatcatcaccccgtttaacgag
gaccgcgtcgaaatcaacaatgcggttcgggcggagctgcaggagcgtggcgagctcgat
gtcaacgactcggcacacaccatcttccggtccgatggagatatgacccgggccaagcag
aaggaggcgcagtactacactaaggatatgaccgtccggttcggtcgagactatcagaaa
atactcgcctcccgcggcgaatacatgcgcgttgtgggtacgcgacccgacgagggtatc
gtcgttctgcggaagtccgacgggtctctcatggaatgggaaccgaagaagtacaaccgg
gtagaggtgtatctctcggaaacgaggaatctcgccgcgcgtgacgtcattcgcttcacc
cgcggcgacgagctcgtcaagaatggtcacgaggcgaccgtcgtttctgtcaacgagaac
caggcggtcctgcggctcgcggatggcaaggaaattccttgggatctcgacgcgcagcgt
cattgggatcacgcgtatgcggtgacggttcacgcaggccaaggcgcgacccgcgagcaa
gccatgctgcatatcccgtcacacaaaatggagcgtgatccggaagatgctcggcgccag
tcagacgtcgcgatgacggtgcgtaggatcttcggtgaccggagcttctatgtcgggctc
acccgggcggtcgaggatctccagattttcacgaccgacgcaattctcgctcgagcggcc
gtctcacgccaccaggacaagtcaagcgccatcgagacgctgcgtgagcatgagttgggc
gagcaggcgaatacccagccgcagcgccagcgacgtcaacaagctgcgcaacagatgcag
atcgagccggactga

DBGET integrated database retrieval system