KEGG   Borreliella chilensis: OY14_02775Help
Entry
OY14_02775        CDS       T03543                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bchi  Borreliella chilensis
Pathway
bchi00030  Pentose phosphate pathway
bchi00480  Glutathione metabolism
bchi01100  Metabolic pathways
bchi01110  Biosynthesis of secondary metabolites
bchi01120  Microbial metabolism in diverse environments
bchi01130  Biosynthesis of antibiotics
bchi01200  Carbon metabolism
Module
bchi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bchi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OY14_02775
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OY14_02775
Enzymes [BR:bchi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     OY14_02775
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     OY14_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA NAD_Gly3P_dh_N F420_oxidored 3HCDH_N Shikimate_DH NAD_binding_11 IlvN PepSY_like 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJA90361
UniProt: A0A0A7UVN9
Position
571434..572828
Genome map
AA seq 464 aa AA seqDB search
MDIGIYGLGVMGGNLALNIADNGFNVSVYNRDSEKTEIFVKQNSHKKISGFKDIESFVKS
LKTPRKIILMVTSLAVEKVIEQILPFVDKLDVIIDGGNSHYKSTMRLEKELFAKDIYFVG
LGISGGERGARFGPALMYGGSKSAYEILEPILNKIAARTKTNDVCSTYIGENGSGHYVKM
IHNGVEYADMQLISEVYFFMKKAFNLDNSKISEVFEKWNEGDLSSYLLEVTSKILRYKEN
NEYLVDKILDIANQKGTGVWTSIDALESNMPVNLIVESVFSRFMSGLKHERIIASDLLKM
DTVSFEFELSDWILDLYYALLVSKVVAYAQGFMMLKTASANYSWDLNLGKISLIWREGCI
IRSSFLDKIKLAYDKNPHLINLLFDDYFLDLLKNHHKSLRRIISKASEIGIPLPAFYASL
SFLDSYSTNYLPSNLIQAQRDFFGAHSFERLDSKRGEFFHSSWQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
ttggatataggaatttatggtcttggtgttatgggtggtaatttagcactaaatattgct
gataacggttttaatgtttctgtttataatagagatagtgaaaaaactgaaatttttgtt
aaacaaaattctcataaaaagataagtggttttaaagatattgaatcttttgttaaaagc
ttgaagactccaagaaaaatcatcttgatggtgacaagtttggctgtagaaaaggttatt
gaacaaattttgccttttgtagataaattggacgtaattattgacggtggaaattctcat
tataagagtacaatgagacttgaaaaagaactgtttgctaaagacatttattttgtagga
cttggaatttctgggggggagagaggagcaagatttggccctgcgttaatgtatggagga
agtaaatcagcttatgaaattcttgagcctatattaaataaaattgcagctagaactaaa
accaacgatgtttgttcgacttatattggagaaaatggttctgggcactatgttaaaatg
atacataatggggtggaatacgctgatatgcaacttatcagtgaggtttattttttcatg
aaaaaagctttcaatctagataattcaaaaatttctgaagtttttgaaaagtggaatgag
ggggatctttcgagttatttactagaagtaacttctaagattcttaggtataaggaaaat
aatgaatatttagttgataaaattttagatattgcaaatcaaaaaggtactggtgtttgg
acttctattgatgctcttgaatctaatatgcctgtgaatttaattgttgaatctgttttt
tcaagatttatgtcggggttaaaacacgaaaggattattgctagtgatttgctcaagatg
gataccgtctcttttgagtttgagcttagtgattggattttggatctttattatgctctt
ttagtttcaaaagtagtagcttatgctcaaggttttatgatgcttaagaccgcatctgct
aattatagttgggatttgaatttgggtaaaatttctttaatttggagagagggctgtatt
attcgcagtagttttttagataaaattaaattagcttatgataaaaatccccatcttatt
aatttactttttgatgattattttttagatttattaaaaaatcatcacaaatctttgaga
agaataatttcaaaagctagtgagattggaatacctttgcctgcattttatgctagcctt
tcgtttttagattcttattctactaattatttaccttccaacctaattcaggcacaaaga
gatttttttggtgcacattcttttgaaagattagattcaaaacgaggtgaattttttcat
agttcttggcaataa

DBGET integrated database retrieval system