KEGG   Bifidobacterium choerinum: BcFMB_06905Help
Entry
BcFMB_06905       CDS       T05748                                 

Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bcho  Bifidobacterium choerinum
Pathway
bcho00670  One carbon pool by folate
bcho01100  Metabolic pathways
bcho01120  Microbial metabolism in diverse environments
bcho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BcFMB_06905
Enzymes [BR:bcho01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BcFMB_06905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ATU20691
UniProt: A0A2D3D5L7
Position
1736967..1737803
Genome map
AA seq 278 aa AA seqDB search
MPIFSLEIFPPKRTAPVGTIYDTLDGLQGLSPAFISVTYGTGKSVDRTATARIANTVRAE
YGIPAVAHLTAQYLDEAGADEALDLFDQAKVAGILALRGDRNPEREPANVFSHASDLAAF
IRERRPDMPIYGACYPEKHPQAASLDEDIDNLKRKVDAGVTHLISQLFYDDEDFLRFRDK
ARAAGIDVPIEAGIMPVVNAGSVRHMADLCGSRIPERLAVMLEMWGQDPASLKEAGVVYA
SEQIRDLVARGVDGIHLYTMNRPCAARRIWANTKVFFA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcttctcgctcgagatcttccctcctaaacgcaccgcgccggtcggcacgatc
tacgacacgctcgacggcctgcagggcctgagtcccgcgttcatctccgtgacctacggc
accggcaaatcggtcgaccgcaccgccaccgcgcgcatcgcgaacaccgtgcgcgccgaa
tacggcatccccgccgtcgcccacctgaccgcccagtacctcgacgaggccggcgccgac
gaggcgctcgacctgttcgaccaggcgaaggtcgccggcatcctcgcactgcgcggcgac
cgcaaccccgaacgcgaaccggccaacgtgttcagccacgcgtccgacctggccgcgttc
atccgcgaacgccgccccgacatgccgatctacggcgcctgctacccagagaagcatccg
caggcggcgagtctcgacgaggacatcgacaacctcaaacgcaaggtcgacgccggcgtc
acccacctgatctcccagctgttctacgacgacgaggacttcctgcgcttccgcgacaag
gcgcgcgccgccggcatcgacgtgccgatcgaagcgggcatcatgcccgtcgtcaacgcg
ggctcggtgcgccacatggccgacctgtgcggctcgaggatccccgagaggctcgccgtc
atgctcgagatgtggggacaggaccccgcatccctcaaggaggccggcgtcgtctacgcg
tccgagcagatccgcgacctcgtcgcccgcggcgtcgacggcatccacctgtatacgatg
aaccggccgtgcgccgcccggcgcatctgggcgaacacgaaggtgttcttcgcctga

DBGET integrated database retrieval system