KEGG   Bifidobacterium choerinum: BcFMB_07570Help
Entry
BcFMB_07570       CDS       T05748                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcho  Bifidobacterium choerinum
Pathway
bcho00020  Citrate cycle (TCA cycle)
bcho00480  Glutathione metabolism
bcho01100  Metabolic pathways
bcho01110  Biosynthesis of secondary metabolites
bcho01120  Microbial metabolism in diverse environments
bcho01200  Carbon metabolism
bcho01210  2-Oxocarboxylic acid metabolism
bcho01230  Biosynthesis of amino acids
Module
bcho_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BcFMB_07570
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BcFMB_07570
Enzymes [BR:bcho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BcFMB_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATU20800
UniProt: A0A2D3D797
Position
1882472..1883689
Genome map
AA seq 405 aa AA seqDB search
MTKIKVEGTVVELDGDEMTHVIWKDIKDRLILPYLDVNLDYYDLSIQNRDATDDQVTIDA
AEAIKREHVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILGGTIFREPIVISNIPRL
VPGWTKPIVVARHAFGDQYKATDFKVPGPGSLTVTFTPQDGSAPIEHLVFDYPGSGVAQV
QYNLDDSIRGFARACFNYGLLRGYPVYLSTKNTILKAYDGEFKDIFAEVFETEYKERYEQ
EGLTYEHRLIDDMVASSLKWHGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGQ
TVEAEAAHGTVTRHYRRWQKGEKTSTNPIASIYAWTGGLKHRAKLDGTPDVADFAEKLEQ
TIIATVEGGQMTKDLALLIGPDHPWLDTEGFMDALDENLNKALRG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatcaaggtcgaaggcacggtcgtcgagctcgacggcgacgagatgacgcac
gtcatctggaaggacatcaaggaccgtctcatcctgccctacctcgacgtcaacctcgac
tactatgacctgagcatccagaaccgcgacgcgaccgacgaccaagtgacgatcgacgcc
gccgaggcgatcaagcgcgagcacgtcggcgtcaaatgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggaagtcgccgaacggcacgatccgc
aacatcctcggcggcacgatcttccgcgagccgatcgtcatctcgaacatcccgcgcctc
gtgccgggctggacgaagccgatcgtcgtcgcccgccacgccttcggcgaccagtacaag
gcgaccgacttcaaggtcccgggcccgggaagcctgacggtgaccttcacaccgcaggac
ggctccgcgccgatcgagcatctcgtcttcgactatccgggatccggcgtcgcgcaggtg
cagtacaacctcgacgactcgatccgcggcttcgcgcgcgcctgcttcaactacggactg
ctgcgcggctacccggtctacctgtccacgaagaacacgatcctcaaagcatacgacggc
gagttcaaggacatcttcgccgaggtgttcgagaccgaatacaaggaacgctacgagcag
gagggcctcacctacgagcaccgcctcatcgacgacatggtcgccagctccctcaagtgg
cacggcggctacgtgtgggcctgcaagaactacgacggcgacgtgcagtccgacaccgtc
gcacagggcttcggctcgctcggcctgatgacctcggtgctgatgacccccgacggccag
accgtcgaggccgaggccgcgcacggcaccgtcacccgccactaccgccgctggcagaag
ggcgagaagacgtcgacgaacccgatcgcgtcgatctacgcgtggacgggcggcctcaag
caccgcgcgaagctcgacggcacgcccgatgtcgccgacttcgccgagaagctcgagcag
acgatcatcgcgaccgtcgagggcggccagatgacgaaggacctcgcgctgctcatcggc
cccgatcatccgtggctcgacaccgaaggcttcatggacgcgctcgacgagaacctgaac
aaggcgctgcgcggctga

DBGET integrated database retrieval system