KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_304Help
Entry
BCHRO640_304      CDS       T02430                                 

Gene name
tilS
Definition
(GenBank) tRNA(Ile)-lysidine synthase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Brite
KEGG Orthology (KO) [BR:bchr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bchr03016]
    BCHRO640_304 (tilS)
Enzymes [BR:bchr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     BCHRO640_304 (tilS)
Transfer RNA biogenesis [BR:bchr03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BCHRO640_304 (tilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS_C TilS
Motif
Other DBs
NCBI-ProteinID: AGC03569
UniProt: L0MUM2
Position
344561..346093
Genome map
AA seq 510 aa AA seqDB search
MITTNTSSENWDLYRKVTHCLVGHTRLLLSYSGGLDSTVLLDILTRLKNNSDHFTLSPFM
LRAIYIHHGISNYSDEWASHCFNQCKIRGIPFSVIHINCYNTENKQRNIEALARNLRYKK
LYNRLNSKEILLTAHHMNDQVESLFLALKRGSGPSGLSGMSKNALYANKYRLLRPLLDCS
REQLEIYAYKKKLVWIEDDTNTDTRFDRNFLRIKILPSIYQRWPCFNQVVARTAQLCRDQ
ENLLNELLSESFQKLIDESDGSLLFIPLFQYSIPKRQALLRRWLSHLSMKMPSYQLINRI
WKEVVLSRKDATPILQLDKYLCRRFREKLYILPVNMRCSLNRIELSWNIIHNVFILPYNL
GKLIYQPLSINEHVPKNPFDLHLNIDSSLNTSHDVFEKYKKVLTHCFVRSPKSDEKISII
FGNIDGLLYILGRNRGRHLKKIWQELGVPPWLRSRIPLLFYNKTLITAIGVFITQNGKIT
SKENTLWKISWLQDIISYKIFKNSVRYHLE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaaccaatacatcgtcagaaaattgggatttatatcgtaaagtaacacattgt
cttgtcggacatacaagattactgttgtcttatagtggaggactggattccacagtactt
ttagatatattaacaagattaaaaaataattctgatcatttcacattatctccgttcatg
ttgcgcgcaatctatatacaccatggtattagtaattattcggatgaatgggctagtcat
tgttttaatcaatgtaaaatacggggcatacctttttcagtaattcatatcaattgctat
aatacagaaaataaacaacgaaatatagaagcattagcacgaaatcttcgttataaaaaa
ttatacaatcgtttaaattcaaaagaaatacttttgaccgcgcatcacatgaatgatcaa
gtagaaagtttattccttgcactaaagagagggagtggtccatctggactatctggaatg
agtaaaaatgcattatatgctaataaatacaggttattaagacctttattggattgctct
cgtgaacaattagaaatatatgcttataaaaaaaaacttgtttggatagaagacgatacg
aatacagatacacgttttgatcgtaattttttgcgcataaaaattttgccatcaatatat
caacgttggccttgttttaatcaagtagttgcgcgtactgcgcaactatgcagagatcaa
gaaaatttattaaatgaattgttgtcagaatcttttcaaaaattaattgatgaatcagat
ggttctttattatttatcccattatttcaatacagcataccgaaaagacaagctttacta
cggcgttggttatcgcatctttctatgaagatgccttcttatcaacttataaatcgtatt
tggaaagaagtagtattaagtcggaaagatgcaaccccaatactacaattagataaatac
ctatgtcgtcgttttcgtgaaaagttgtatattttacctgtaaatatgagatgttcttta
aatagaattgaattatcatggaacatcatacataatgtatttatactaccatataattta
ggtaaattaatataccaaccattaagtatcaacgaacatgtgcctaaaaatccatttgat
ctgcatttaaacatagattcttcattaaacacgtctcatgatgtttttgaaaaatataaa
aaagttttaacgcattgttttgttcgatccccaaaatctgatgaaaaaatatcaattatt
tttggaaatatagatgggttattatatatcttaggaagaaatcgtggccgacatttaaaa
aaaatttggcaggaattaggcgtacctccatggctaagaagtcgtattcctttgcttttt
tacaataaaacattaattactgccataggagtattcattactcaaaatggtaaaattaca
agtaaagagaatacgttatggaaaatatcttggttacaagatattatatcttataaaata
tttaaaaatagcgttcgttatcatttagaataa

DBGET integrated database retrieval system