KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_352Help
Entry
BCHRO640_352      CDS       T02430                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
bchr00020  Citrate cycle (TCA cycle)
bchr00640  Propanoate metabolism
bchr00660  C5-Branched dibasic acid metabolism
bchr01100  Metabolic pathways
bchr01110  Biosynthesis of secondary metabolites
bchr01120  Microbial metabolism in diverse environments
bchr01130  Biosynthesis of antibiotics
bchr01200  Carbon metabolism
Module
bchr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCHRO640_352 (sucC)
   00640 Propanoate metabolism
    BCHRO640_352 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BCHRO640_352 (sucC)
Enzymes [BR:bchr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCHRO640_352 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AGC03611
UniProt: L0MWU7
Position
406878..408053
Genome map
AA seq 391 aa AA seqDB search
MNLYEYQAKKLMEKYNLPVLKGFVCATINDIEHCIVSNSIGYGPWVVKCQVRAGGRGKSG
GVCVVHSTKNILSFANKWLGNRLITYQTTDTGEIVTSILIEPAVKIVQEFYLSILIDRDE
SQIICMASTQGGMNIEITEQKTPNFIHKIVINPSVGIYPYQGRVLACKLGLSGAKINQFS
RIIVSITRMLLEHDLTLIEINPLAITDDDCFYCLDAKMIVDRNAIFRQSELLNICAINKP
IDMLNFINYIPLEGNIGCMVNGAGLAMATMDVMKSLGGIPANFLDIGGGANKECIISAFN
MILKNTKVQAILVNIFGGIVCCDLVAECIITALSRYTTKHIPIVARLEGNNSTLGSNRLI
NSKLNIIVTDNLIYAIQQSVTAVNLKNVNFS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatatgaatatcaagcaaaaaaattaatggaaaaatacaatttacctgttttg
aaaggttttgtatgtgctactataaatgatatagagcattgtattgtatcaaatagtata
ggttatggcccatgggtagtaaaatgtcaagtgcgagcaggagggcgcgggaaatcaggt
ggagtatgtgttgtacattccacgaaaaatatattatcttttgctaataaatggcttggt
aatagattgataacatatcaaactaccgataccggggaaatagtgacttctattttaata
gaaccagctgtaaaaattgttcaagaattttatttaagcatattaattgatagagatgaa
tcccaaataatatgtatggcttctacgcaaggtggtatgaacattgaaattacagaacaa
aaaacacccaattttattcacaaaattgtcataaatccttcagtaggaatatatccgtat
caaggacgggtattagcatgtaaattaggcttatctggagccaaaataaatcaattttcc
agaattattgttagcataacacgtatgctgctggaacatgacctaacgttaattgaaatt
aatccattagctattactgatgatgattgtttttattgtttagatgccaaaatgattgta
gatcgtaatgccatatttagacaatcagaattgttaaatatatgcgctataaataaacca
atcgatatgctgaattttatcaattatattcccttggagggaaatattggctgtatggtc
aatggcgctgggttagcaatggctactatggatgtaatgaaatcattaggagggattcct
gctaattttttagacatcgggggcggcgctaataaagaatgcataatatcagcttttaat
atgattttaaaaaatactaaagtgcaagcgatacttgtaaatatttttggtggaattgta
tgctgtgatttagttgctgagtgtatcataactgcattgtccagatataccacaaaacat
attcctattgtggctcggttagaaggcaataattctacattaggttctaatcgattaatt
aatagcaaacttaatattattgttaccgataatttaatttatgcaattcaacaaagtgta
actgcggtgaacttaaaaaatgtcaattttagttaa

DBGET integrated database retrieval system