KEGG   Candidatus Blochmannia chromaiodes (Camponotus chromaiodes): BCHRO640_624Help
Entry
BCHRO640_624      CDS       T02430                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bchr  Candidatus Blochmannia chromaiodes (Camponotus chromaiodes)
Pathway
bchr00860  Porphyrin and chlorophyll metabolism
bchr01100  Metabolic pathways
bchr01110  Biosynthesis of secondary metabolites
bchr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bchr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCHRO640_624 (hemD)
Enzymes [BR:bchr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BCHRO640_624 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGC03852
UniProt: L0MX60
Position
724470..725219
Genome map
AA seq 249 aa AA seqDB search
MNILITRPSPYGEQLVNKLLSFGKFAYHFPLIYFSTGKELYSLEQKLNLLSEGDFLCIIS
QHAIKYAHNQLLNIGISWPTKLAYYSIGHATSVMMYKLSGILVKYPTIQETSENLLQLPE
LMYSYGKRALILRGNNGRTILDDTLQRRGVFVASCECYTRQPLQYNREEQLSNLLGLNIR
TVVVTSGEILQHLYYLIPESYRTSWLIRCKLIVVSVRLAKLARRLGWTNIIIAQSANNEI
LTHLLIKNA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttaattactcgtccttctccatatggagaacaattggtaaataaattactt
tcttttggtaaatttgcatatcattttccattaatttacttttctacaggaaaagaatta
tattcattagaacagaaattaaatctactttctgaaggagattttttgtgcattatatca
caacatgcaattaaatatgctcataatcagttacttaacataggaatatcctggcctacc
aaattagcatattattccattggtcatgcgactagtgtaatgatgtacaagttatcggga
atattggtgaaatatcctacaatccaggaaactagtgaaaatttattacaattacctgaa
ctaatgtatagttatggaaagcgcgctcttattctaagaggtaataatggacgtactatt
ttagatgacactcttcaaagaagaggagtatttgttgcatcctgcgaatgttatactaga
caaccgttgcaatataatagagaagaacaattatctaatctattaggattgaatattaga
acagtagtagttacttctggagaaatactacaacacctatattatttaattcctgaatct
tatcgcacatcttggttgatacgatgtaaattaatcgtggtaagtgtacgtctagctaaa
ttagctagacgtttaggttggacaaatattattatagcgcagtcagcaaacaacgagata
ctaactcatcttttgattaagaatgcataa

DBGET integrated database retrieval system