KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0062Help
Entry
BCI_0062          CDS       T00349                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
bci00860  Porphyrin and chlorophyll metabolism
bci01100  Metabolic pathways
bci01110  Biosynthesis of secondary metabolites
bci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCI_0062 (hemD)
Enzymes [BR:bci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BCI_0062 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABF14120
UniProt: Q1LU24
Position
73173..73913
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEKLVEKLRAYGKLAWHLPLIRFLPGMDLPMLGRHFMALCQDDLLFILS
QHAIVYAHSWLLQQSINWPARLRYFTVGSTSGLLLHQFSGLPVNYPHQCETSEGLLNLPS
LASIDGRRALILRGNGGRKILKQTLLQRGVKVEDCECYRRYPIPYDGNEQGRRLLSLGIN
TLVITSGEMLQQFYTLIPKSYHYFLLIQCRLIVVSERLAILAHKLGWQDIIIVNITDHDA
LMRVLR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcttagttacacgaccttctcctgcgggggagaagctcgtagagaaactacgc
gcttatggtaaattagcctggcatctaccgcttattcgctttttacctggtatggatctc
cctatgttaggaagacattttatggctctttgtcaagatgatttgctgtttattttatca
caacatgctattgtatatgctcattcttggttactacagcaaagtattaattggccggca
agactacgatatttcactgttggtagtactagcggattactattacatcagtttagtggt
ttaccggtaaactatccacaccaatgtgaaactagcgaaggattactaaatttaccttct
cttgcttctatcgatgggcggcgtgcgctaatattacgtggtaatggaggaagaaaaata
ctaaaacaaacgctcctacagcgaggagtaaaagtggaagattgtgaatgttatcgtcga
taccctattccttatgatgggaatgaacaaggtcgtcgcttactatcgcttgggataaat
acattagtaatcactagtggtgaaatgttgcaacaattctatactttaatccccaaaagt
tatcactattttttactaatccaatgtagattaatagtagtaagtgaacgtttagctatc
cttgctcataaattaggctggcaagatattatcatcgttaatattacagatcatgatgct
ttaatgcgcgtattacggtaa

DBGET integrated database retrieval system