KEGG   Baumannia cicadellinicola Hc (Homalodisca coagulata): BCI_0482Help
Entry
BCI_0482          CDS       T00349                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bci  Baumannia cicadellinicola Hc (Homalodisca coagulata)
Pathway
bci00270  Cysteine and methionine metabolism
bci00480  Glutathione metabolism
bci01100  Metabolic pathways
Module
bci_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCI_0482 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCI_0482 (gshB)
Enzymes [BR:bci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BCI_0482 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABF14244
UniProt: Q1LSZ5
Position
complement(494302..495255)
Genome map
AA seq 317 aa AA seqDB search
MIKLGIVMDSIASINIKKDTSFALLLEAQKRGYKIFYMEINSLYLRGGEARASSCLLEVT
NHDDDWYNFYNYQDIAISSLDVVLMRKNPPIDTEYIYSTYILERAEKQGTLVINKPQSLR
DCNEKIFASDCKKYTPDTLVSQQYNHIRQFLRQHKDIILKPLNGMGGQSIFRLQEQDPNL
SVIIETLTSYGKNFCMAQTYLPSIKEGDKRVFIIDGQPVPYCLARIPQNSEIRGNLAAGG
YGEARSLSSTDWSIAYDLGLILRKRGLMFVGLDIIGDKLTEINITSPTCICEIEAAFPIS
ITGMLMDAIEKNLQTIK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgattaagttaggtattgtaatggattctattgcatccattaatattaagaaagatact
agtttcgcgcttttgctcgaagcgcaaaaacgtggctataaaattttttatatggaaatt
aattctctttatttacgtggtggagaagctcgagcttctagttgtttgctagaagttact
aatcatgatgatgattggtataatttttataactatcaagatatagctataagctctctt
gatgttgttttaatgcgtaaaaatccaccaatagatactgaatatatttattcaacttat
attctagaacgtgcggaaaaacaaggtacacttgttattaacaaaccacaaagcctacgt
gattgtaacgaaaaaatatttgcttctgattgcaaaaaatataccccagatacactagtt
agtcagcaatataatcatattcgtcaatttttacgacagcataaggacattatccttaaa
ccattaaatggtatgggaggtcaatctatctttcgtcttcaagagcaagatcctaatctt
tcagttattattgaaactttgactagctatggtaaaaatttttgtatggcgcaaacttat
cttccatccattaaagaaggagataagcgtgtttttattattgatggccaaccagtacca
tactgcttagctcgtattcctcaaaatagtgaaatacgtggtaatttagccgctggtgga
tacggagaagcacgttctttatcatcaactgattggtcaattgcttacgatttaggctta
atactaagaaaaagaggattaatgtttgtcggtttagatattattggtgataaactaaca
gagatcaatataactagtcctacctgcatatgcgaaatagaagctgctttcccaatatct
attactggtatgttaatggatgctattgaaaaaaatcttcagactattaaatag

DBGET integrated database retrieval system