KEGG   Candidatus Baumannia cicadellinicola BGSS: IM45_029Help
Entry
IM45_029          CDS       T03277                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bcib  Candidatus Baumannia cicadellinicola BGSS
Pathway
bcib00010  Glycolysis / Gluconeogenesis
bcib00020  Citrate cycle (TCA cycle)
bcib00620  Pyruvate metabolism
bcib01100  Metabolic pathways
bcib01110  Biosynthesis of secondary metabolites
bcib01120  Microbial metabolism in diverse environments
bcib01130  Biosynthesis of antibiotics
bcib01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IM45_029
   00020 Citrate cycle (TCA cycle)
    IM45_029
   00620 Pyruvate metabolism
    IM45_029
Enzymes [BR:bcib01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     IM45_029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: AIN46901
UniProt: A0A088N0Q1
Position
complement(19727..21340)
Genome map
AA seq 537 aa AA seqDB search
MNLQQLNLISYGITDCCEIIYNPSFEQLFVEETNQYLTGFERCTVTSSGAVAVNTGIFTG
RSPFDKYLVRDKNTSHKLWWSDDQNDNDNHPISQDTWEHLKILVGKQLSSKRLFIIDVFC
GAKEDNRLRVRFITEVAWQAHFVKNMFIRPNETDLKVFEPDFVVLNGAKCTNPNWREQGM
HSENFIAFNLTEGMQLIGGTWYGGEMKKGIFSVMNYKLPLKGIASMHCSANVGANDDVAL
FFGLSGTGKTTLSHDSKRRLIGDDEHGWDDNGIFNLEGGCYAKTMHLNAEAEPDIFQAIR
RDALLENVVVRIDGSVDYNDSSKTENTRVSYPIYHIENIVKPVSYASHASTVIFLTADAF
GVLPPVATLTAEQAQYYFLSGFTAKLSGTERGVMAPIPTFSACFAAAFLSLHPTIYAAML
AKRMEAVGTSAYLVNTGWNGSGNRISITDTRIIINAILSRKINEAPKINLPIFNLTIPQN
LVGINSTLLDPRMTYVNQAEWQKKASDLAQSFIDNFNQLTKMFAVQVQGLHSAGPQL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacagcagttaaacttaattagttatggaattacagactgctgtgaaataata
tataatcctagttttgagcagttatttgtcgaagagactaaccagtacttaactggtttt
gagcgctgtactgttactagctcaggcgcagtagcggtaaatactggtatttttactggt
cgatcaccgtttgataaatatttagtacgggataaaaataccagccataaattatggtgg
tcagatgatcagaacgataatgataatcatcctattagccaagatacctgggaacatctc
aagatattggtaggtaagcagctaagcagcaagcgtttatttattattgatgtattttgc
ggcgctaaggaagacaatagattacgggtgcgcttcatcactgaagttgcttggcaggca
catttcgtaaaaaatatgtttatccgtccaaatgaaacagatctcaaagtttttgaacct
gactttgtggtactaaacggggccaaatgtactaaccctaattggcgcgaacaaggtatg
cattcagaaaattttattgcttttaatttaaccgaaggaatgcagctgattggtggtact
tggtacggaggcgaaatgaaaaaaggcatattttcggtgatgaactataaattgccactg
aaaggcatagcatcgatgcattgttcggctaatgttggtgcaaatgatgatgtagcactt
ttcttcggcctatcaggcacaggcaaaactacactctctcatgattctaaacgacgcctt
attggcgacgatgaacatggttgggacgataatggtatttttaatttagaaggtggctgc
tatgctaaaactatgcacttaaatgcagaggcagagccagatatttttcaggccatccga
cgtgatgcgctgttagaaaacgtagtagtacgaattgatggttcagtagattacaatgac
agtagtaaaactgaaaatacacgtgtatcctacccaatttatcatatcgaaaatattgtc
aaaccagtatcgtatgctagccatgcttcgacggtaatttttctgacagccgacgccttc
ggtgtgttaccaccagtagcaactttaacggcagaacaagcacaatattatttcttatct
ggttttaccgcaaagttatctggtactgaacgtggtgtaatggcaccgattcccacattc
tccgcttgttttgcagcagcttttttatcactgcatccgacgatatatgcggctatgcta
gctaagaggatggaggctgttggtactagtgcttacttagtaaatacgggttggaatggc
agtggtaatcgtatatctattacagatacccggataattatcaatgcgatattaagcaga
aagattaatgaggcgccaaaaataaacctaccaatttttaatctaactatacctcaaaat
ctagttggtatcaatagtactcttctcgatccacgtatgacttatgtcaatcaagctgaa
tggcagaaaaaagcgagcgatctcgctcaaagttttatcgataattttaatcaattaact
aaaatgtttgcagtacaagtacagggattacatagcgctggaccacagctttaa

DBGET integrated database retrieval system