KEGG   Candidatus Baumannia cicadellinicola BGSS: IM45_1239Help
Entry
IM45_1239         CDS       T03277                                 

Definition
(GenBank) CO2+/MG2+ efflux protein ApaG protein
  KO
K06195  ApaG protein
Organism
bcib  Candidatus Baumannia cicadellinicola BGSS
Brite
KEGG Orthology (KO) [BR:bcib00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    IM45_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIN47484
UniProt: A0A088MZ42
Position
complement(657698..658042)
Genome map
AA seq 114 aa AA seqDB search
MMTNASRICIKVQRMKSQLEENRYVFTDTITLQIMGRYLLITNAYGQETEVQSKDVIGEQ
LLIIASGKFQYTSGGVLETPLGTMQRYYEMLDYEGQSFRVALLIFRLAIPTIIN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaatgcgtcccgtatttgcattaaggtacaaagaatgaagtctcaactagaa
gaaaatcgctatgtttttacagataccatcacactacaaattatgggccgctatttgttg
attaccaacgcttatggtcaggaaacagaagtacaaagcaaggatgtgatcggggaacaa
ctgttgattatagcgagcggcaagtttcaatatactagtggtggggtcctagaaacacca
cttgggactatgcagcgatattacgaaatgctagattatgaaggacagagctttcgtgtt
gctctccttatcttccgtctagcaattcctacgatcataaactaa

DBGET integrated database retrieval system