KEGG   Candidatus Baumannia cicadellinicola BGSS: IM45_499Help
Entry
IM45_499          CDS       T03277                                 

Definition
(GenBank) Siroheme synthase / Precorrin-2 oxidase / Sirohydrochlorin ferrochelatase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
bcib  Candidatus Baumannia cicadellinicola BGSS
Pathway
bcib00860  Porphyrin and chlorophyll metabolism
bcib01100  Metabolic pathways
bcib01110  Biosynthesis of secondary metabolites
bcib01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcib00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    IM45_499
Enzymes [BR:bcib01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     IM45_499
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     IM45_499
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     IM45_499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Radical_SAM Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AIN47127
UniProt: A0A088MXV1
Position
complement(265314..266723)
Genome map
AA seq 469 aa AA seqDB search
MLNKKYFAVEYLPLFANLRRRTVLVVGGGHVAARKIELLMRTGAQIRVVARELCPQLTGI
INNRDINWLGPIFEPAMLDEVFLVIAATDDAELNARVYKCADERHTLVNVVDEQQNCSFI
FPSIVDRSPIIVAISSSGKAPVLARIIREQIESMLPMFLGTMATIAGTWRSRIKQYICNM
AGRRSFWEKAFNGSFANMVAQGKLEQAEQELEYQLYNCPSQSGNVALVGAGPGDSGLLTL
RGLQLMQQADVVLYDYLVNPEIIDLVRRDADRVCVGKRVGEHSMPQAEINRLLVKLAQQG
KNVVRLKGGDPFIFGRGGEELQEVAAAGISFQVVPGITAAAGATAYAGIPLTHREYAQSV
TFITGHPRDDGDFIDWPSLARCNQTLVVYMGVMKAAVINRKLVAHGRAPQTPVAVISRGT
YTDQKVLIGTLEQLEMLALQALPPALLVIGDVVALSHEINWFGQENLIA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
ttgcttaacaaaaaatattttgctgtggaatatttaccactatttgccaatcttaggcga
cgtacggttttggtagttggcggaggccacgttgctgcgcgcaaaatagagttactgatg
cgtacgggcgcgcaaatcagggtagtagcgcgtgagttatgtcctcagctaacaggtatt
atcaataatcgcgatattaactggctgggtccaatattcgaaccagctatgctcgatgag
gtctttctagttattgcggcaactgacgacgcagaactgaacgcacgagtctataagtgc
gcagatgagcgccatacattagttaatgtagtagatgaacagcaaaactgctcgtttatt
tttccatcgatcgtggatcgctcgccgataatagtagctatatcatcgagcgggaaagca
ccagtgctagcgcgtattatacgtgaacaaattgagtctatgctacccatgtttctcggc
acgatggcgaccatagctggtacctggcgcagccgtatcaaacagtatatctgtaatatg
gcggggcgccggagcttctgggaaaaagcatttaatggtagttttgcgaatatggtagct
caaggtaaattagaacaagcggagcaggaactagagtatcagctatataactgcccgtcc
caaagcggaaacgtagctttggtaggtgctggtcctggtgatagcgggttgctaacttta
cgcggactgcaactcatgcagcaggcagatgtggtgctatatgactatctagtcaaccct
gaaattatagatttagtacgccgcgatgctgatcgcgtctgcgtcggtaagcgagtaggt
gaacattctatgccacaggcagagattaatcgtttactagttaagctggcacagcagggt
aaaaatgtcgtgcggctcaaaggtggcgacccatttatctttggtcgcggtggcgaagag
ctgcaggaagtcgctgccgctggtatttcgttccaggtagtacccggcatcaccgctgcc
gctggcgctacggcctatgccggaattccgttgacccaccgagagtatgctcagagtgta
acttttattacaggtcatccgcgcgatgacggcgatttcatagactggccgtcgttggcg
cgctgcaatcaaactctagtagtttacatgggtgtgatgaaagcagcggtaataaatcgt
aagctcgtggctcatggccgcgcgccgcagactccggtagcagtgataagccgtggtact
tatacagatcagaaagttcttattggcacactagaacagttagaaatgttagctctacag
gcgctgcctcctgcgctactagtcatcggtgatgttgtggccctttctcatgaaatcaat
tggtttggtcaggagaatttaatagcgtaa

DBGET integrated database retrieval system