KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_132Help
Entry
AB162_132         CDS       T04544                                 

Gene name
murI
Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig00471  D-Glutamine and D-glutamate metabolism
bcig01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AB162_132 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcig01011]
    AB162_132 (murI)
Enzymes [BR:bcig01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AB162_132 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bcig01011]
 Precursor biosynthesis
  Racemase
   AB162_132 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race pRN1_helical
Motif
Other DBs
NCBI-ProteinID: AKZ65751
UniProt: A0A0K2BK05
Position
150711..151544
Genome map
AA seq 277 aa AA seqDB search
MLDKNTNPTILVIDSGVGGFSILYEVKKIIKNVNYIYVFDNEEFPYGKKTKQFLLSRVIK
IINSVCKIHSIDIIIIACNTLSTVSLPLLRRYFICPIIGVLPAIKLAAKITRSRVIGLLA
TQTTINSNYTNVLIKKLASSYKIIPFIATKLVYLAEDKFHGKIISLIIFKNILNAWLKQV
IKLNLDTIILGCTHFPLIYEELRKIIPKNIKLIYSHKAIAKKALCILKYNNKYNTLLSNN
TSTINTIYCLLFNNNTTILMPKLSKYGFHSMKKLYIY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaaaatacaaaccctactattttagtaatagattctggagtaggtggtttt
tctattttatatgaagtaaaaaaaattataaaaaatgttaattatatatatgtttttgat
aatgaagaatttccttatggaaaaaaaactaaacaatttcttctctcaagagtaattaaa
attattaattcggtatgtaaaatacattctatagatattattattattgcttgtaatact
ttaagtacagtatcattaccattacttcgtagatattttatctgtcctattattggagtt
ctaccagcaattaaattagcagctaaaattactcgtagtagagttattggtttattagct
acacaaacaacaataaatagcaattatacaaatgttttaataaaaaaacttgcatcttcc
tataaaattataccttttatagctactaaattagtgtacttagcggaagataagtttcat
ggaaaaataatatcattaattatttttaaaaatattttaaatgcatggctgaaacaagtt
attaaattaaatttagatacaattatacttggatgtacacattttccattaatttatgaa
gaattaagaaaaattattcctaaaaacataaaattaatttattcacataaagctattgct
aaaaaagctttatgtattctaaaatataataataaatataatactttattaagtaataat
acatcaacaatcaatactatttattgtttattatttaataataatactacgatattaatg
cctaaattatctaaatatggatttcatagtatgaaaaaattatacatttattaa

DBGET integrated database retrieval system