KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_253Help
Entry
AB162_253         CDS       T04544                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig00030  Pentose phosphate pathway
bcig00480  Glutathione metabolism
bcig01100  Metabolic pathways
bcig01110  Biosynthesis of secondary metabolites
bcig01120  Microbial metabolism in diverse environments
bcig01130  Biosynthesis of antibiotics
bcig01200  Carbon metabolism
Module
bcig_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bcig_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AB162_253 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AB162_253 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcig04147]
    AB162_253 (zwf)
Enzymes [BR:bcig01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AB162_253 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AB162_253 (zwf)
Exosome [BR:bcig04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AB162_253 (zwf)
  Exosomal proteins of colorectal cancer cells
   AB162_253 (zwf)
  Exosomal proteins of bladder cancer cells
   AB162_253 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AKZ65854
UniProt: A0A0K2BKX5
Position
complement(277806..279272)
Genome map
AA seq 488 aa AA seqDB search
MAVTSIAQACDLVIFGAKGDLARRKLLPSLYQLEKACYIHPETRIIGVGRAEWDIKAYTY
MVRKALETFMKEKIDEKIWNILSTRLNFCNFDINETKNFFILAEKIDPMSRVIINYFAMP
ANTFSSICQGLKEININNNPHRIVLEKPLGTSLESSRIINDQVAKYFKENQIYRIDHYLG
KETVLNLLALRFANSLFANNWNNSNIDHVQITVAEEVGIEGRWSYFDQAGQMRDMIQSHL
LQILTIIAMSPPADLTTDNIRDEKVKILRSLRTIDNSNVHDTTVRGQYTEGWINGKKVPG
YLEEEGANKNSLTETFVSIRVNIDNWQWAGVPFYLRTGKRLPIKCSEVVVYFKNPPINLF
RDSYQPLPPNKLTIRLQPDEGMEIQIVNNVPRLGNKHCLKTTKLDLSFTKTFNKNISDAY
ERLLLETMRGIQSLFVRRDEIEEAWKWVDSIIEAWKKNNDAPQPYQAGTWGPIASVTMMT
KDSRSWHN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgacatccatagcccaagcatgtgatctagtaatttttggcgcaaaaggagat
ttagctcgtcgtaagttattaccatctttgtatcagctagaaaaagcttgttatattcat
cctgaaacacgcattattggtgtgggtcgtgcagaatgggatattaaagcttacacttat
atggtacgcaaagcgctagaaacttttatgaaagaaaaaattgacgaaaaaatatggaat
atattaagcacgcgtttaaatttttgtaattttgatataaatgaaacaaaaaattttttt
attttagcagaaaaaatagatcctatgtccagagtaataattaattattttgctatgcca
gcaaatacttttagctctatttgtcaaggattaaaagaaattaacattaataacaatcct
caccgtatagtactagaaaaaccattaggtactagtttagaatcatcgcgcatcattaat
gatcaagttgctaaatactttaaagaaaaccaaatataccgtatcgatcattatcttggc
aaagaaacagtactaaatttactggctcttaggtttgctaattctttatttgcaaataat
tggaataacagtaatatagatcacgtacaaattacagtagctgaagaagttggtatcgaa
ggacggtggagttattttgatcaagctggtcaaatgcgtgatatgattcaaagccatttg
ctacaaatattaactattatcgctatgtcacctcctgctgatttaaccacagataatatt
agagatgaaaaagttaaaatactacgttctctacgtacgatcgataatagtaatgtgcat
gatactacagtacgtggtcagtatactgaaggatggattaatggtaaaaaagtccctggt
tatttagaagaagaaggcgcaaataaaaacagtcttactgaaacttttgtttctattcgt
gtcaatattgataattggcaatgggcaggagtaccattttatttacgtactggtaagcgt
ttaccgatcaaatgttcagaagtagttgtatattttaaaaatccacctattaacttattt
cgcgattcatatcaaccacttccaccaaataagctaactattagactgcagccagatgaa
ggaatggaaattcagattgtaaataatgtacctaggcttggcaataaacattgcctcaaa
actactaagttagatctaagttttactaaaacttttaataaaaatatatcagatgcttat
gaacgtcttttattagaaactatgcgaggaattcaatctctttttgttcgaagagatgaa
atcgaagaagcatggaaatgggtagattcaattatcgaagcttggaaaaaaaataatgat
gcaccacaaccatatcaagcaggtacctggggacctatagcatcagttaccatgatgact
aaagatagtcgctcttggcataattaa

DBGET integrated database retrieval system