KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_253
Entry
AB162_253         CDS       T04544                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig00030  Pentose phosphate pathway
bcig00480  Glutathione metabolism
bcig01100  Metabolic pathways
bcig01110  Biosynthesis of secondary metabolites
bcig01120  Microbial metabolism in diverse environments
bcig01200  Carbon metabolism
Module
bcig_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bcig_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AB162_253 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AB162_253 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcig04147]
    AB162_253 (zwf)
Enzymes [BR:bcig01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AB162_253 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AB162_253 (zwf)
Exosome [BR:bcig04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AB162_253 (zwf)
  Exosomal proteins of colorectal cancer cells
   AB162_253 (zwf)
  Exosomal proteins of bladder cancer cells
   AB162_253 (zwf)
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-ProteinID: AKZ65854
UniProt: A0A0K2BKX5
Position
complement(277806..279272)
AA seq 488 aa
MAVTSIAQACDLVIFGAKGDLARRKLLPSLYQLEKACYIHPETRIIGVGRAEWDIKAYTY
MVRKALETFMKEKIDEKIWNILSTRLNFCNFDINETKNFFILAEKIDPMSRVIINYFAMP
ANTFSSICQGLKEININNNPHRIVLEKPLGTSLESSRIINDQVAKYFKENQIYRIDHYLG
KETVLNLLALRFANSLFANNWNNSNIDHVQITVAEEVGIEGRWSYFDQAGQMRDMIQSHL
LQILTIIAMSPPADLTTDNIRDEKVKILRSLRTIDNSNVHDTTVRGQYTEGWINGKKVPG
YLEEEGANKNSLTETFVSIRVNIDNWQWAGVPFYLRTGKRLPIKCSEVVVYFKNPPINLF
RDSYQPLPPNKLTIRLQPDEGMEIQIVNNVPRLGNKHCLKTTKLDLSFTKTFNKNISDAY
ERLLLETMRGIQSLFVRRDEIEEAWKWVDSIIEAWKKNNDAPQPYQAGTWGPIASVTMMT
KDSRSWHN
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggctgtgacatccatagcccaagcatgtgatctagtaatttttggcgcaaaaggagat
ttagctcgtcgtaagttattaccatctttgtatcagctagaaaaagcttgttatattcat
cctgaaacacgcattattggtgtgggtcgtgcagaatgggatattaaagcttacacttat
atggtacgcaaagcgctagaaacttttatgaaagaaaaaattgacgaaaaaatatggaat
atattaagcacgcgtttaaatttttgtaattttgatataaatgaaacaaaaaattttttt
attttagcagaaaaaatagatcctatgtccagagtaataattaattattttgctatgcca
gcaaatacttttagctctatttgtcaaggattaaaagaaattaacattaataacaatcct
caccgtatagtactagaaaaaccattaggtactagtttagaatcatcgcgcatcattaat
gatcaagttgctaaatactttaaagaaaaccaaatataccgtatcgatcattatcttggc
aaagaaacagtactaaatttactggctcttaggtttgctaattctttatttgcaaataat
tggaataacagtaatatagatcacgtacaaattacagtagctgaagaagttggtatcgaa
ggacggtggagttattttgatcaagctggtcaaatgcgtgatatgattcaaagccatttg
ctacaaatattaactattatcgctatgtcacctcctgctgatttaaccacagataatatt
agagatgaaaaagttaaaatactacgttctctacgtacgatcgataatagtaatgtgcat
gatactacagtacgtggtcagtatactgaaggatggattaatggtaaaaaagtccctggt
tatttagaagaagaaggcgcaaataaaaacagtcttactgaaacttttgtttctattcgt
gtcaatattgataattggcaatgggcaggagtaccattttatttacgtactggtaagcgt
ttaccgatcaaatgttcagaagtagttgtatattttaaaaatccacctattaacttattt
cgcgattcatatcaaccacttccaccaaataagctaactattagactgcagccagatgaa
ggaatggaaattcagattgtaaataatgtacctaggcttggcaataaacattgcctcaaa
actactaagttagatctaagttttactaaaacttttaataaaaatatatcagatgcttat
gaacgtcttttattagaaactatgcgaggaattcaatctctttttgttcgaagagatgaa
atcgaagaagcatggaaatgggtagattcaattatcgaagcttggaaaaaaaataatgat
gcaccacaaccatatcaagcaggtacctggggacctatagcatcagttaccatgatgact
aaagatagtcgctcttggcataattaa

DBGET integrated database retrieval system