KEGG   Burkholderia cenocepacia J2315: BCAL0042Help
Entry
BCAL0042          CDS       T00771                                 

Gene name
putA
Definition
(GenBank) bifunctional PutA protein [includes: proline dehydrogenase; delta-1-pyrroline-5-carboxylate dehydrogenase]
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00250  Alanine, aspartate and glutamate metabolism
bcj00330  Arginine and proline metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCAL0042 (putA)
   00330 Arginine and proline metabolism
    BCAL0042 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bcj03000]
    BCAL0042 (putA)
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BCAL0042 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BCAL0042 (putA)
Transcription factors [BR:bcj03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BCAL0042 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH RHH_1
Motif
Other DBs
NCBI-ProteinID: CAR50348
UniProt: B4EF02
Position
1:48506..52438
Genome map
AA seq 1310 aa AA seqDB search
MASTTLGVKVDDLLRSRLKDAAARLERTPHWLIKQAIFAYLERIEHGQLPPELSGHSGVT
ELADGQAADGDDDNSPHPFLEFAQNVQPQSVLRAAITAAYRRPEPECVPFLLGQARLPAN
LQADVQALATKLAEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDA
LIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGRGGEPL
IRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDAQRYYAS
YEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQDRTMSELLPRVRALALLARRY
DIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQGYQKRCPFVIDYLIDLARR
SRHRLMIRLVKGAYWDTEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQ
FATHNAYTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTH
ETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVDEASKVVPLGAPHAKIPLPRN
LYGDERPNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALADAPARDVRNPADQ
RDVVGTVSEATSEHVSAALAHAVAAAPIWQATPVDARADCLVRAADLLEAQMHTLMGLIV
REAGKSLPNAIAEIREAVDFLRYYAAQIRGEFSNDTHRPLGPVVCISPWNFPLAIFMGQV
AAALAAGNTVLAKPAEQTPLIAAQAVRLLREAGVPAGAVQLLPGTGETVGAALVADARTR
AVMFTGSTEVARLINKTLSARLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVMQSS
FDSAGQRCSALRVLCLQDDVADRTLTMLKGAMHELALGNPDRLSTDVGPVIDAEAKQTID
THIAAMKDKGHTVTQLPMPDACAHGTFVPPTLIEIGSIDELKREVFGPVLHVVRYRRSQL
DKLLEQIRATGYGLTLGIHTRIDETIAHVISNAHVGNIYVNRNVIGAVVGVQPFGGEGLS
GTGPKAGGALYLQRLLATRPSGLPRALAQSLVADGATESDARGNPAAALTTLRDWLIEQR
EPALAARCDGYLAQVPAGATAVLTGPTGERNTYTLGPRGTVLCVAATPGGARAQFAAVLA
TGNRALFAGAAGEALVAALPASLKAHAAVRKQADAPFDAVLFEGDSDELQTLVKDVAQRP
GPIVSVQGVSAGAFENGGAEDYALERLLTERSVSVNTAAAGGNANLMTIG
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcacgactctcggcgtcaaagtcgacgaccttctccgctcgcgcctcaaggac
gccgccgcgcgtctcgagcgcactccccactggctgatcaagcaggcgatcttcgcgtat
ctcgagcggatcgagcacggccagttgccgcccgagctgtcgggccacagcggcgtgacg
gagctcgccgacggtcaggccgcggacggcgacgacgacaactcgccgcatccgttcctc
gagttcgcgcagaacgtgcagccgcaatcggtgctgcgcgcggcgatcacggccgcgtac
cgccgtccggaaccggagtgcgtgccgttcctgctcggccaggcgcgcttgcccgcgaac
ctgcaggcggacgtgcaggcgctcgcgacgaagctggccgaggcgctgcgcgagaagagc
tcgggcggcggcgtcgaagggctgatccacgagttttcgctgtcgagccaggaaggcgtc
gcgctgatgtgcctcgccgaagcgctgttgcgcattcccgaccgtgcgacgcgcgacgcg
ctgatccgcgacaagatcagcaagggcgactggcgctcgcacgtcggccatgcgccgtcg
ctgttcgtgaacgcggcgacctgggggctgatgatcaccggcaagctcgtgacgaccaac
agcgaagcgggcctgtcgtcggcgctcacgcgcctgatcggccgcggcggcgagccgctg
atccgcaagggcgtcgacatggccatgcgcctgatgggcgagcagttcgtcaccggcgaa
acgatttccgaagcgctcgcgaacagccgcaagtacgaagcgcgcggcttccgctactcg
tacgacatgctcggcgaagcggcgaccaccgaagaggacgcgcagcgctactacgcgtcg
tacgaacaggcgatccacgcgatcggcaaggcggccggcggccgcggcatctacgaaggc
ccgggcatctcgatcaagctgtcggcgctgcatgcgcgctactcgcgctcgcagcaggac
cgcacgatgagcgagctgctgccgcgcgtgcgcgcgctcgcgctgctcgcgcgccgctat
gacatcggcctgaacatcgacgcggaagaagccgaccgtctcgaactgtcgctcgacctg
ctcgaggcactgtgcttcgatccggagctcgccggctggaacggcatcggtttcgtcgtg
cagggctaccagaagcgctgcccgttcgtgatcgactacctgatcgatctcgcgcgccgc
agccgtcatcgcctgatgatccgcctcgtgaagggcgcgtactgggataccgagatcaag
cgggcgcaggtcgacggcctcgaaggctatccggtctacacgcgcaagatctacaccgac
gtgtcgtacctcgcgtgcgcgaagaagctgctcgccgcgccggacgccgtgtacccgcag
ttcgcgacgcacaacgcgtacacgctggccgcgatctaccagctcgcgggccagaactac
tacccgggccagtacgaattccagtgcctgcacgggatgggcgagccgctgtacgaggaa
gtcaccggtcgcgacaagctgaaccgcccgtgccgcgtgtacgcgccggtcggcacgcac
gagacgctgctcgcgtacctcgtgcgccgtctgctggaaaacggcgcgaacacgtcgttc
gtgaaccgcatcgccgataagaccgtgtcggtgaaggagctcgttgccgatccggtcgac
gaagcgtcgaaggtcgtgccgctcggcgcgccgcacgcgaagatcccgctgccgcgcaac
ctgtatggcgacgagcgtcccaactcgatgggcctcgacctgtcgaacgaacaccgtctc
gcgtcgctgtcgtccgcgctgctcgcgagcgcgcaccacccgtggcgcgcggcgccgatg
ctcgccgacgacgcgctcgccgatgcgccggcgcgcgacgtgcgcaacccggccgaccag
cgcgacgtggtcggcacggtcagcgaagcgacgtccgaacacgtgagcgcggcgctcgcg
cacgcggtggccgccgcgccgatctggcaggcgacgccggtcgacgcgcgcgccgattgc
ctggtgcgcgccgccgacctgctcgaagcgcagatgcacacgctgatgggcctgatcgtg
cgcgaagccggcaagtcgctgccgaacgcgatcgccgagatccgcgaagcggtcgacttc
ctgcgctactacgcggcgcagatccgcggcgagttctcgaacgacacgcaccgcccgctc
ggccccgtggtctgtatcagcccgtggaacttcccgctcgcgatcttcatgggccaggtc
gccgcggcgctcgccgccggcaacacggtgctcgcgaagccggccgaacagacgccgctg
atcgccgcgcaagccgtgcgcctgctgcgcgaggccggcgtgccggccggcgcggtgcaa
ctgctgccgggcaccggcgagaccgtcggtgcggcgctggtcgccgatgcgcgcacgcgt
gcggtgatgttcaccggttcgaccgaagtcgcacgcctgatcaacaagacgctgtccgcg
cgcctcgacccggacggcaagccgattccgctgatcgcggaaacgggcggccagaacgcg
atgatcgtcgattcgtcggcgctcgcggagcaggtcgtcgcggacgtgatgcagtcgtcg
ttcgactcggccggtcaacggtgttcggcgctgcgcgttctgtgtctgcaggacgacgtc
gcggaccgcacgctgacgatgttgaagggcgcgatgcacgagctggcgctcggcaacccg
gaccggctgtcgaccgacgtcggcccggtgatcgacgccgaggcgaagcagacgatcgac
acgcacatcgcggcgatgaaggacaagggccacacggtcacgcaactgccgatgcccgac
gcatgcgcgcacggcacgttcgtgccgccgacgctgatcgagatcggcagcatcgacgag
ttgaagcgcgaagtgttcggccccgtgctgcacgtggtgcgctaccgccgcagccagctc
gacaagctgctcgagcagatccgcgcgaccggctacgggctgacgctcggcatccacacg
cggatcgacgagacgatcgcgcacgtgatctcgaatgcgcacgtgggcaacatctacgtg
aaccgcaacgtgatcggcgcggtggtcggcgtgcagccgttcggcggcgaagggctgtcg
ggcacgggcccgaaggccggtggcgcgctgtacctgcagcgcctgctcgcgacgcgtccg
tcggggctgccgcgcgcgctcgcgcagtcgctggtggcggacggcgcgaccgaaagcgat
gcacgcggcaatccggcggcggcgctcacgacgctgcgcgactggctgatcgagcagcgc
gagccggcgctggccgcgcgttgcgacggctacctcgcacaggtgccggccggcgcgacc
gcggtgctgaccgggccgacgggcgagcgaaacacgtatacactcggcccgcgcggcacg
gtgctgtgtgtcgcggccacgccgggcggcgcgcgtgcgcagttcgcggcggtgctcgcg
accggcaaccgcgcactgttcgccggcgcggcgggcgaggcgctggtcgccgcgctgccg
gcgtcgctgaaggcgcacgcggcggtgcgcaagcaggccgacgcgccgttcgacgcggtg
ctgttcgaaggcgacagcgacgaactgcagacgctcgtgaaggacgtcgcgcagcggccg
ggcccgatcgtgtcggtgcagggcgtatcggcgggcgcgttcgagaacggcggcgcggaa
gactacgcgctcgagcggctgttgacggaacgctcggtgagcgtgaacacggccgcggcg
ggcggcaatgcgaatttgatgacgatcggctga

DBGET integrated database retrieval system