KEGG   Burkholderia cenocepacia J2315: BCAL0396Help
Entry
BCAL0396          CDS       T00771                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01130  Biosynthesis of antibiotics
bcj01230  Biosynthesis of amino acids
Module
bcj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCAL0396 (trpC)
Enzymes [BR:bcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCAL0396 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAR50707
UniProt: B4E7A7
Position
1:complement(429520..430305)
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEVATAMRSTPLEALKLDASARDLRDFVGALRAKHAAGNAAVIAEIK
KASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGGVRYLEEARAACSLPVLRK
DFIVDAYQIVEARAMGADAILLIAAALDTPLMQDLEAYAHSLGLAVLVEVHDRHEMEQAL
TLKTPLLGINNRNLRTFETSIQTTLDMLDMIPADRIVVTESGILSRTDVDTMRAANVNTF
LVGEAFMRADQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgcgaagaagtcgcgacggccatg
cgcagcacgccgctcgaggcactgaaactcgacgcatcggcgcgcgacctgcgcgacttc
gtcggcgcgctgcgggcgaagcatgcggccggcaacgccgccgtgatcgccgaaatcaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgt
tcgtatgcggcgcacggcgccgcgtgcctgtcggtgctgaccgacgagcagttcttccag
ggcggcgtgcgctatctcgaggaagcgcgcgcggcctgctcgctgccggtgctgcgcaag
gacttcatcgtcgacgcataccagatcgtcgaagcccgcgcgatgggcgccgacgcgatc
ctgctgatcgccgccgcgctcgacacgccgctgatgcaggatctcgaagcgtatgcgcat
tcgctcgggctcgcggtgctggtcgaagtacacgaccgccacgagatggaacaggcgctg
acgctgaagacgccgctgctcggcatcaacaaccgcaacctgcgcacgttcgagacgtcg
atccagaccacgctcgacatgctcgacatgattccggcggaccgcatcgtcgtgaccgaa
tccggcatcctgtcgcgcaccgacgtcgacacgatgcgcgcggcgaacgtgaacacgttc
ctcgtcggcgaagcgttcatgcgcgccgaccagccgggcgaggaactcgcacggatgttc
ttctga

DBGET integrated database retrieval system